SIMATIC HMI HMI device OP 73micro, TP 177micro (WinCC flexible)
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
_
_____________
Introduction
Overview 1
Safety instructions and
general notes 2
Planning use 3
Mounting and connection 4
Operator control components
and LEDs 5
Configuring the operating
system 6
Preparing and backing up a
project 7
Operating a project 8
Operating alarms 9
Maintenance and servicing 10
Specifications 11
Appendix A
Abbreviations B
SIMATIC HMI
HMI device
OP 73micro, TP 177micro
(WinCC flexible)
Operating Instructions
09/2007
A5E01006740-02
Order No. 6AV6691-1DF01-0AB0
Safety Guidelines
Safety Guidelines
This manual contains notices you have to observe in order to ensure your personal safety, as well as to prevent
damage to property. The notices referring to your personal safety are highlighted in the manual by a safety alert
symbol, notices referring only to property damage have no safety alert symbol. These notices shown below are
graded according to the degree of danger.
DANGER
indicates that death or severe personal injury will result if proper precautions are not taken.
WARNING
indicates that death or severe personal injury may result if proper precautions are not taken.
CAUTION
with a safety alert symbol, indicates that minor personal injury can result if proper precautions are not taken.
CAUTION
without a safety alert symbol, indicates that property damage can result if proper precautions are not taken.
NOTICE
indicates that an unintended result or situation can occur if the corresponding information is not taken into
account.
If more than one degree of danger is present, the warning notice representing the highest degree of danger will
be used. A notice warning of injury to persons with a safety alert symbol may also include a warning relating to
property damage.
Qualified Personnel
The device/system may only be set up and used in conjunction with this documentation. Commissioning and
operation of a device/system may only be performed by qualified personnel. Within the context of the safety notes
in this documentation qualified persons are defined as persons who are authorized to commission, ground and
label devices, systems and circuits in accordance with established safety practices and standards.
Prescribed Usage
Note the following:
WARNING
This device may only be used for the applications described in the catalog or the technical description and only
in connection with devices or components from other manufacturers which have been approved or
recommended by Siemens. Correct, reliable operation of the product requires proper transport, storage,
positioning and assembly as well as careful operation and maintenance.
Trademarks
All names identified by ® are registered trademarks of the Siemens AG. The remaining trademarks in this
publication may be trademarks whose use by third parties for their own purposes could violate the rights of the
owner.
Disclaimer of Liability
We have reviewed the contents of this publication to ensure consistency with the hardware and software
described. Since variance cannot be precluded entirely, we cannot guarantee full consistency. However, the
information in this publication is reviewed regularly and any necessary corrections are included in subsequent
editions.
Siemens AG
Automation and Drives
Postfach 48 48
90437 NÜRNBERG
GERMANY
Order Nr.: 6AV6691-1DF01-0AB0
Ⓟ 09/2007
Copyright © Siemens AG 2007.
Technical data subject to change
이 기기는 업무용(A급) 전자파 적합기기로서 판매자 또는 사용자는 이 점을 주의하시기 바라며 가정 외의 지역에서 사용하는 것을 목적으로 합니다.
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 3
Introduction
Purpose of the operating instructions
This operating instruction manual provides information based on the requirements defined by
DIN 8418 for mechanical engineering documentation. This information relates to the device,
its place of use, transport, storage, installation, use and maintenance.
These operating instructions are intended for:
● Users
● Commissioning engineers
● Service technicians
● Maintenance technicians
Please read the section "Safety instructions and general notes" carefully.
The help integrated in WinCC flexible, the WinCC flexible Information System, contains
detailed information. The Information System contains instructions, examples and reference
information in electronic form.
Basic knowledge required
General knowledge of automation technology and process communication is needed to
understand the operating instructions.
It is also assumed that those using the manual have experience in using personal computers
and knowledge of Microsoft operating systems.
Operating instructions' range of validity
The operating instruction manual applies to the OP 73micro and TP 177micro HMI devices in
connection with the WinCC flexible software package.
Introduction
OP 73micro, TP 177micro (WinCC flexible)
4 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Position in the information landscape
These operating instructions form part of the SIMATIC HMI documentation. The following
information provides you with an overview of the SIMATIC HMI information landscape.
User manuals
● WinCC flexible Micro:
Describes basic principles of configuration using the WinCC flexible Micro Engineering
System.
● WinCC flexible Compact/Standard/Advanced:
Describes basic principles of configuration using the WinCC flexible Compact
Engineering System/WinCC flexible Standard/WinCC flexible Advanced
● WinCC flexible Runtime:
Describes how to commission and operate your runtime project on a PC.
● WinCC flexible Migration:
– Describes how to convert an existing ProTool project to WinCC flexible.
– Describes how to convert an existing WinCC project to WinCC flexible.
– Describes how to convert an existing ProTool project including a change of the HMI
device, e.g. from OP7 to OP 77B or OP7 to OP 77B.
– Describes how to convert an existing ProTool project including a change from a
graphics device to a Windows CE device.
● Communication:
– Communication Part 1 describes the connection of the HMI device to SIMATIC PLCs.
– Communication Part 2 describes the connection of the HMI device to third-party PLCs.
Operating instructions
● Operating instructions for SIMATIC HMI devices.
– OP 73micro, TP 177micro
– OP 73, OP 77A, OP 77B
– TP 177A
– TP 170micro, TP 170A, TP 170B, OP 170B
– Mobile Panel 170
– TP 270, OP 270
– MP 270B
– MP 370
● Operating instructions (compact) for the HMI devices SIMATIC OP 77B and Mobile
Panel 170
Introduction
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 5
Getting Started
● WinCC flexible for first time users:
Based on an example project, this is a step-by-step introduction to the basics of
configuring screens, alarms, recipes and screen navigation.
● WinCC flexible for advanced users:
Based on an example project, this is a step-by-step introduction to the basics of
configuring logs, project reports, scripts, user management and multilingual projects and
integration in STEP 7.
● WinCC flexible options:
Based on an example project, this is a step-by-step introduction to the basics of
configuring the WinCC flexible Sm@rtServices, Sm@rtAccess and OPC Server options.
Online availability
Technical documentation on SIMATIC products and SIMATIC systems is available in PDF
format in various languages at the following addresses:
● SIMATIC Guide Technische Dokumentation in Deutsch:
"http://www.ad.siemens.de/simatic/portal/html_00/techdoku.htm"
● SIMATIC Guide for Technical Documentation in English:
"http://www.ad.siemens.de/simatic/portal/html_76/techdoku.htm"
Conventions
Configuration and runtime software differ with regard to their names as follows:
● "WinCC flexible 2004," for example, refers to the configuration software.
The term "WinCC flexible" is used in a general context. The full name, for example
"WinCC flexible 2004", is always used when it is necessary to differentiate between
different versions of the configuration software.
● "WinCC flexible Runtime" refers to the runtime software that can run on HMI devices.
Text is highlighted as follows to simplify reading the operating instructions:
Notation Scope
"Add screen" • Terminology that appears in the user interface, e.g., dialog
names, tabs, buttons, menu entries
• Inputs required, e.g., limit values, tag values
• Path information
"File > Edit" Operational sequences, e.g., menu commands, context menu
commands
<F1>, <Alt+P> Keyboard operation
Please observe notes labeled as follows:
Note
Notes contain important information concerning the product, its use or a specific section of
the documentation to which you should pay particular attention.
Introduction
OP 73micro, TP 177micro (WinCC flexible)
6 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Registered trademarks
Names labeled with a ® symbol are registered trademarks of the Siemens AG. Other names
used in this documentation may be trademarks, the use of which by third parties for their
own purposes could violate the rights of the owner.
● HMI®
● SIMATIC®
● SIMATIC HMI®
● SIMATIC ProTool®
● SIMATIC WinCC®
● SIMATIC WinCC flexible®
● SIMATIC OP 73micro®
● SIMATIC TP 177micro®
Representatives and offices
If you have any further questions relating to the products described in this manual, please
contact your local representative at the SIEMENS branch nearest you.
Find your contact partner at:
"http://www.siemens.com/automation/partner"
Training center
Siemens AG offers a variety of training courses in order to familiarize you with automation
systems. Please contact your regional training center or the central training center in D-
90327 Nuremberg, Germany.
Phone: +49 (911) 895-3200
Internet: "http://www.sitrain.com"
Service & support on the Internet
Service & Support offers online services for additional, comprehensive information on
SIMATIC products at
"http://www.siemens.com/automation/support":
● The newsletter offers you the latest information about your products.
● A large document base is available using our Service & Support search engine.
● A forum for global exchange of information by users and experts
● Current product information, FAQs and downloads
● Your local Automation & Drives representative
● Information about field service, repairs, spare parts and much more under the heading
"Services"
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 7
Table of contents
Introduction................................................................................................................................................ 3
1 Overview.................................................................................................................................................. 11
1.1 Product overview .........................................................................................................................11
1.2 Design of the OP 73micro HMI device.........................................................................................12
1.3 Design of the TP 177micro HMI device .......................................................................................13
1.4 Accessories..................................................................................................................................13
1.5 Miscellaneous ..............................................................................................................................14
1.6 Range of HMI software functions.................................................................................................14
1.7 Communication with PLCs...........................................................................................................16
2 Safety instructions and general notes...................................................................................................... 17
2.1 Safety instructions........................................................................................................................17
2.2 Standards, Certificates and Approvals ........................................................................................18
2.3 Notes about usage.......................................................................................................................20
2.4 Electromagnetic compatibility ......................................................................................................23
2.5 Transport and storage conditions ................................................................................................25
3 Planning use............................................................................................................................................ 27
3.1 Mounting information ...................................................................................................................27
3.2 Mounting the OP 73micro ............................................................................................................30
3.2.1 Mounting positions and fixation....................................................................................................30
3.2.2 Preparing for mounting ................................................................................................................31
3.3 Mounting the TP 177micro...........................................................................................................33
3.3.1 Mounting positions and fixation....................................................................................................33
3.3.2 Preparing for mounting ................................................................................................................35
3.4 Information on insulation tests, protection class and degree of protection..................................37
3.5 Nominal voltages .........................................................................................................................38
4 Mounting and connection......................................................................................................................... 39
4.1 Checking the package contents...................................................................................................39
4.2 Mounting and connecting the OP 73micro...................................................................................39
4.2.1 Mounting the HMI device .............................................................................................................39
4.2.2 Connecting the HMI device..........................................................................................................40
4.2.2.1 Interfaces .....................................................................................................................................41
4.2.2.2 Connecting the equipotential bonding circuit...............................................................................42
4.2.2.3 Connecting the PLC.....................................................................................................................44
4.2.2.4 Connecting the configuration computer .......................................................................................44
4.2.3 Switching on power and testing the HMI device..........................................................................46
Table of contents
OP 73micro, TP 177micro (WinCC flexible)
8 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.3 Mounting and connecting the TP 177micro ................................................................................ 48
4.3.1 Mounting the HMI device ............................................................................................................ 48
4.3.2 Connecting the HMI device......................................................................................................... 49
4.3.2.1 Interfaces .................................................................................................................................... 50
4.3.2.2 Connecting the equipotential bonding circuit .............................................................................. 50
4.3.2.3 Connecting the PLC.................................................................................................................... 53
4.3.2.4 Connecting the configuration computer ...................................................................................... 53
4.3.3 Switching on power and testing the HMI device ......................................................................... 55
4.4 Communication with S7-200 ....................................................................................................... 57
4.4.1 Topologies................................................................................................................................... 57
4.4.1.1 Communication via a point-to-point connection..........................................................................57
4.4.1.2 Communication in the network.................................................................................................... 58
4.4.1.3 Configuration instructions............................................................................................................ 60
4.4.2 Configuring communication ........................................................................................................ 60
4.4.2.1 Configuring protocol parameters................................................................................................. 61
4.4.3 User data areas........................................................................................................................... 63
4.4.3.1 Communication between HMI device and controller .................................................................. 63
4.4.3.2 Permitted data types ................................................................................................................... 63
4.4.3.3 Time synchronization via area pointer ........................................................................................ 64
4.4.3.4 Mechanism of error alarm acknowledgment............................................................................... 66
5 Operator control components and LEDs.................................................................................................. 69
5.1 Front side operator control components and indicators on the OP 73micro .............................. 69
5.2 Front side operator control components and LEDs on the TP 177micro.................................... 70
6 Configuring the operating system ............................................................................................................ 71
6.1 Configuring the operating system for the OP 73micro................................................................ 71
6.1.1 Overview ..................................................................................................................................... 71
6.1.2 "Info/Settings" menu.................................................................................................................... 72
6.1.2.1 Overview ..................................................................................................................................... 72
6.1.2.2 Setting screen contrast ............................................................................................................... 74
6.1.2.3 Displaying information about the HMI device.............................................................................. 74
6.1.2.4 Viewing information about the version of the HMI device image................................................ 75
6.1.3 "Settings" menu........................................................................................................................... 75
6.1.3.1 Overview ..................................................................................................................................... 75
6.1.3.2 Setting the delay ......................................................................................................................... 76
6.1.3.3 Setting the screen saver ............................................................................................................. 76
6.1.3.4 Assigning, editing and deleting passwords................................................................................. 77
6.1.3.5 Configure the data channel......................................................................................................... 79
6.2 Configuring the operating system for the TP 177micro .............................................................. 80
6.2.1 Overview ..................................................................................................................................... 80
6.2.2 Control Panel .............................................................................................................................. 81
6.2.2.1 Overview ..................................................................................................................................... 81
6.2.2.2 Changing screen settings............................................................................................................ 82
6.2.2.3 Displaying information about the HMI device.............................................................................. 84
6.2.2.4 Calibrating the touch screen ....................................................................................................... 85
6.2.2.5 Changing the password setting for the Control Panel ................................................................ 86
6.2.2.6 Setting the Screen Saver ............................................................................................................ 87
6.2.2.7 Configure the data channel......................................................................................................... 88
7 Preparing and backing up a project ......................................................................................................... 89
7.1 Overview ..................................................................................................................................... 89
7.1.1 Setting the operating mode......................................................................................................... 90
7.1.2 Reusing existing projects ............................................................................................................ 91
Table of contents
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 9
7.1.3 Data Transfer Options..................................................................................................................92
7.2 Transfer........................................................................................................................................92
7.2.1 Overview ......................................................................................................................................92
7.2.2 Starting transfer............................................................................................................................93
7.2.3 Testing a project ..........................................................................................................................94
7.3 Backup and restore......................................................................................................................95
7.3.1 Overview of backup and restoring ...............................................................................................95
7.3.2 Resetting to Factory Settings for Backup and Restore................................................................96
7.3.3 Backup and Restore via WinCC flexible ......................................................................................96
7.3.4 Backup and Restore via ProSave................................................................................................98
7.4 Updating the operating system ..................................................................................................100
7.4.1 Overview ....................................................................................................................................100
7.4.2 Updating the operating system using WinCC flexible................................................................101
7.4.3 Updating the operating system in ProSave ...............................................................................102
8 Operating a project ................................................................................................................................ 103
8.1 Operating a project on OP 73micro ...........................................................................................103
8.1.1 Overview ....................................................................................................................................103
8.1.2 Setting the project language ......................................................................................................105
8.1.3 Entries and help within a project................................................................................................105
8.1.3.1 Overview ....................................................................................................................................105
8.1.3.2 Entering and Editing Numerical and Alphanumerical Values ....................................................107
8.1.3.3 Entering and editing symbolic values ........................................................................................110
8.1.3.4 Entering and modifying date and time .......................................................................................111
8.1.3.5 Viewing infotext..........................................................................................................................112
8.1.4 Project security ..........................................................................................................................113
8.1.5 Close the project. .......................................................................................................................114
8.2 Operating a project on TP 177micro..........................................................................................115
8.2.1 Overview ....................................................................................................................................115
8.2.2 Setting the project language ......................................................................................................116
8.2.3 Entries and help within a project................................................................................................117
8.2.3.1 Overview ....................................................................................................................................117
8.2.3.2 Entering and editing numerical values.......................................................................................118
8.2.3.3 Entering and editing alphanumerical values..............................................................................120
8.2.3.4 Entering and editing symbolic values ........................................................................................121
8.2.3.5 Entering and modifying date and time .......................................................................................122
8.2.3.6 Viewing infotext..........................................................................................................................123
8.2.4 Project security ..........................................................................................................................124
8.2.5 Close the project. .......................................................................................................................125
8.2.6 Operating the Trend View..........................................................................................................125
8.2.6.1 Overview ....................................................................................................................................125
8.2.6.2 Operating the Trend View..........................................................................................................126
9 Operating alarms ................................................................................................................................... 127
9.1 Overview ....................................................................................................................................127
9.2 Operating alarms on the OP 73micro ........................................................................................128
9.2.1 Displaying alarms.......................................................................................................................128
9.2.2 Acknowledging an Alarm ...........................................................................................................131
9.2.3 Editing an Alarm.........................................................................................................................131
9.3 Operating alarms on the TP 177micro.......................................................................................132
9.3.1 Displaying alarms.......................................................................................................................132
9.3.2 Acknowledging an Alarm ...........................................................................................................134
9.3.3 Editing an Alarm.........................................................................................................................135
Table of contents
OP 73micro, TP 177micro (WinCC flexible)
10 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
10 Maintenance and servicing .................................................................................................................... 137
10.1 Maintenance and service .......................................................................................................... 137
10.1.1 Cleaning screen ........................................................................................................................ 138
10.1.2 Protective membrane................................................................................................................ 138
10.2 Servicing and spare parts ......................................................................................................... 139
11 Specifications ........................................................................................................................................ 141
11.1 Dimensional drawings............................................................................................................... 141
11.1.1 Dimensional drawings, OP 73micro.......................................................................................... 141
11.1.2 Dimensional drawings, TP 177micro ........................................................................................ 142
11.2 Specifications ............................................................................................................................ 143
11.2.1 Specifications of the OP 73micro.............................................................................................. 143
11.2.2 Specifications of the TP 177micro ............................................................................................ 144
11.3 Description of interfaces............................................................................................................ 146
11.3.1 Power supply............................................................................................................................. 146
11.3.2 RS485 (IF 1B) on OP 73micro .................................................................................................. 146
11.3.3 RS 485 (IF 1B) on TP 177micro................................................................................................ 147
A Appendix................................................................................................................................................ 149
A.1 ESD Directives .......................................................................................................................... 149
A.2 System alarms .......................................................................................................................... 151
B Abbreviations......................................................................................................................................... 175
Glossary ................................................................................................................................................ 177
Index...................................................................................................................................................... 183
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 11
Overview 1
1.1 Product overview
Micro Panels OP 73micro and TP 177micro – particularly suitable for SIMATIC S7-200
Our new Micro Panels are tailored to applications with SIMATIC S7-200 Micro PLC and
provide operating and monitoring functions for small-scale machines and plants. Short
configuration and commissioning times, and their configuration in WinCC flexible form
highlights of these panels. In addition, the panels support up to 32 configuration languages
and five online languages, including the Asian and Cyrillic character sets.
The mounting dimensions of the Operator Panel OP 73micro with its graphical 3" display unit
are compatible with OP3 and TD200.
Touch Panel TP 177micro replaces the Touch Panel TP 070/TP 170micro. It can be
mounted vertically to provide additional application. This feature enables its use even when
space is restricted.
Overview
1.2 Design of the OP 73micro HMI device
OP 73micro, TP 177micro (WinCC flexible)
12 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
1.2 Design of the OP 73micro HMI device
Views of the HMI device
1
2
3
4
Figure 1-1 Front and side view
① Display
② Membrane keyboard
③ Clamping recess
④ Mounting seal
Figure 1-2 Bottom view
Overview
1.3 Design of the TP 177micro HMI device
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 13
1.3 Design of the TP 177micro HMI device
Views of the HMI device
Figure 1-3 Front view and side view
① Construction-related opening – not a slot for a memory card
② Mounting seal
③ Display / Touch screen
④ Clamping recess
Figure 1-4 Bottom view
1.4 Accessories
Accessory kit
The accessory kit contains the following:
● A terminal block for the power supply
● Four mounting clamps for installing a TP 177micro
● Two mounting clamps for installing an OP 73
Additional documents may be enclosed with the accessory kit.
Overview
1.5 Miscellaneous
OP 73micro, TP 177micro (WinCC flexible)
14 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
1.5 Miscellaneous
PC-PPI adapter
For the conversion from RS 232 to RS 485, order the PC-PPI adapter, Order No.
6ES7 901- 3CB30-0XA0, from Siemens AG. You need the PC-PPI adapter, for example, to
update the operating system or to transfer project data.
Protective membrane
A protective membrane is available for TP 177micro, order no. 6AV6 671-2XC00-0AX0.
1.6 Range of HMI software functions
General
The following tables show the objects the user can integrate in a project for an OP 73micro
and TP 177micro.
Note
The specified values are maximum values of the individual objects. Simultaneous use of
multiple objects with their maximum value can lead to problems in the active project.
Alarms
Table 1-1 Range of functions for alarms
Object Specification OP 73micro TP 177micro
Number of discrete alarms 250 500
Number of analog alarms 5 20
Length of the alarm text 80 characters 80 characters
Number of tags in an alarm Max. 8 Max. 8
Display Alarm view,
Alarm window
Alarm view,
Alarm window
Acknowledge single error alarms Yes Yes
Acknowledge several error alarms simultaneously
(group acknowledgement)
Yes Yes
Edit alarm Yes Yes
Alarm
Alarm indicator Yes Yes
Alarm buffer capacity 100 alarms 128 alarms
Simultaneously queued alarm events Max. 30 Max. 32
View alarm Yes Yes
Volatile alarm buffer
Delete alarm buffer Yes Yes
Overview
1.6 Range of HMI software functions
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 15
Tags, values and lists
Table 1-2 Range of functions for tags, values and lists
Object Specification OP 73micro TP 177micro
Tags Number 500 250
Limit-value monitoring Input Input/Output
Linear Scaling Input/Output Yes Yes
Text lists Number 150 150
Screens
Table 1-3 Range of functions for screens
Object Specification OP 73micro TP 177micro
Number 250 250
Fields per screen 20 20
Tags per screen 20 20
Complex objects per screen (e.g. bars) 5 5
Screen
Template Yes Yes
Infotext
Table 1-4 Range of functions for infotext
Object Specification OP 73micro TP 177micro
Length (no. of characters) 320 320
For alarms Yes Yes
For screens Yes Yes
For screen objects (e.g. IO fields) Yes Yes
Infotext
Help indicator Yes No
Overview
1.7 Communication with PLCs
OP 73micro, TP 177micro (WinCC flexible)
16 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Additional functions
Table 1-5 Range of additional functions
Object Specification OP 73micro TP 177micro
Monitor settings Contrast
Touch screen calibration
Yes
No
Yes
Yes
Screen saver - Yes Yes
Language switching Number of languages 5 5
Graphic object Graphics Graphics / vector
graphic
Trend views Number - 25
Trends per view Number 4
Text object Number 2500 500
Password protection Number of passwords 1 1
1.7 Communication with PLCs
Number of connections
Interconnection OP 73micro TP 177micro
Number for MPI/PROFIBUS DP 1 1
Siemens PLCs
The following table shows the Siemens PLCs and protocols or profiles that can be used.
PLC Protocol / profile OP 73micro TP 177micro
S7-200 MPI1 yes yes
1 If you require a baud rate of 9.6 Kbps, use the "DP" profile in WinCC flexible.
The HMI device can communicate only with one S7-200 at a time. The HMI device can be
connected to the S7-200 using a PtP connection or a network.
See also
Communication via a point-to-point connection (Page 57)
Communication in the network (Page 58)
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 17
Safety instructions and general notes 2
2.1 Safety instructions
Working on the cabinet
WARNING
Open equipment
The HMI device is an open equipment. This means that the HMI device may only be
installed in cubicles or cabinets, whereby the device can be operated from the front panel.
Access to the cubicle or cabinet in which the HMI device is installed should only be possible
by means of a key or tool and for personnel who have received instruction or are
authorized.
Danger, high voltage
Opening the cabinet will expose high voltage parts. Contact with these parts could be fatal.
Switch off the power supply to the cabinet before opening it.
Hazardous areas
When operating the HMI device in hazardous areas the following warning applies.
WARNING
Explosion Hazard
Do not disconnect while circuit is live unless area is known to be non-hazardous.
Substitution of components may impair suitability for Class I, Division 2 or Zone 2.
High frequency radiation
NOTICE
Unintentional operating situations
High frequency radiation, from mobile phones for example, can cause unintentional
operating situations.
Safety instructions and general notes
2.2 Standards, Certificates and Approvals
OP 73micro, TP 177micro (WinCC flexible)
18 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
2.2 Standards, Certificates and Approvals
Valid approvals
CAUTION
Valid approvals
The overview below provides information on available approvals
The HMI device itself is certified as shown on the label on its rear panel.
CE approval
The automation system meets the general and safety-related requirements of the following
EC directives and conforms to the harmonized European standards (EN) for programmable
logic controllers published in the official gazettes of the European Union:
● 89/336/EEC "Electromagnetic Compatibility" (EMC guideline)
● 94/9/EG "Equipment and protective systems intended for use in potentially explosive
atmospheres" (ATEX).
EC declaration of conformity
The EC declarations of conformity are kept available for the responsible authorities at the
following address:
Siemens Aktiengesellschaft
Automation & Drives
A&D AS RD ST PLC
PO Box 1963
D-92209 Amberg
UL certification
Underwriters Laboratories Inc. conforming to
● UL 508 (Industrial Control Equipment)
● CSA C22.2 No. 142, (Process Control Equipment)
or
Safety instructions and general notes
2.2 Standards, Certificates and Approvals
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 19
Underwriters Laboratories Inc. conforming to
● UL 508 (Industrial Control Equipment)
● CSA C22.2 No. 142, (Process Control Equipment)
● UL 1604 (Hazardous Location)
● CSA-213 (Hazardous Location)
Approved for use in
● Class I, Division 2, Group A, B, C, D or
● Class I, Zone 2, Group IIC or
● non-hazardous locations
FM Approval
FM
APPROVED
Factory Mutual Research (FM) conforming to
● Approval Standard Class Number 3611, 3600, 3810
Approved for use in
● Class I, Division 2, Group A, B, C, D T4
● Class I, Zone 2, Group IIC T4
Ex approval
In compliance with EN 50021 (Electrical apparatus for potentially explosive atmospheres;
Type of protection "n")
● II 3 G/D EEx nA II T4
● IP65
● 04 ATEX 1297X
Tick-mark for Australia
N117
The HMI device fulfills the requirements of standard AS/NZS 2064 (Class A).
Safety instructions and general notes
2.3 Notes about usage
OP 73micro, TP 177micro (WinCC flexible)
20 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
IEC 61131
The HMI device fulfills the requirements and criteria conforming to IEC 61131-2,
Programmable Logic PLCs, Part 2: Operating resource requirements and tests.
2.3 Notes about usage
Use in industry
The HMI device is designed for industrial use. The following standards are met:
● Requirements of the emission of interference EN 61000-6-4: 2001
● Requirements for noise immunity EN 61000-6-2: 2001
Residential use
If the HMI device is used in a residential area, you must take measures to achieve Limit
Class B conforming to EN 55011 for RF interference.
Suitable measures to achieve Limit Class B for suppression of radio interference include:
● Installation of the HMI device in a grounded control cabinet
● Use of filters in electrical supply lines
Use in potentially explosive atmosphere, Zone 2
DANGER
Risk of explosion
Operate the HMI device only in a Zone 2 potentially explosive atmosphere if it has been
identified as approved for such environments.
Figure 2-1 Explosion protection label
● II 3 G/D EEx nA II
● IP65
● 04 ATEX 1297X
WARNING
Personal injury and property damage can occur.
Personal injury and property damage can occur in potentially explosive atmospheres if
an electric plug is disconnected from the HMI device while the system is in operation.
In potentially explosive atmospheres, always turn off power to the HMI device before
disconnecting any connectors.
Safety instructions and general notes
2.3 Notes about usage
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 21
Potentially explosive atmosphere, Zone 2
Potentially explosive atmospheres are organized by zones. The zones are classified
according to the probability of the presence of an explosive atmosphere.
Zone Risk of explosion Example
2 Infrequent and brief development
of an explosive gas atmosphere
Areas around flanged pipe joints with flat
gaskets in closed rooms
Safe zone no • Outside Zone 2
• Standard applications of distributed IO
WARNING
Observe the degree of protection
The HMI device must be installed in a metal enclosure or in a cabinet The minimum degree
of protection of these is IP54 (conforming to EN 60529). Make allowances for the ambient
conditions under which you install the HMI device. The enclosure must have a
manufacturer's declaration for Zone 2 (conforming to EN 50021).
Special conditions for operation in potentially explosive atmospheres of Zone 2
● In situations where the temperature on the cable or at the cable inlet of this enclosure
exceeds 70° C is or the temperature on the wire branching point exceeds 80° C under
operating conditions, the properties of the cables used must ensure that these can
withstand the actually measured temperatures.
● The cable inlets must be compliant with the required degree of protection (conforming
to 50021.)
● All peripheral devices connected to the HMI device must be certified conforming to
explosion protection types EEx nA or EEx nC.
● Measures must be taken to prevent transient voltages from causing the voltage to exceed
its nominal value by more than 40%.
● Ambient temperature range: 0° C ... 50° C vertical
● The temperature of the HMI device's cabinet surface should not exceed 60° C.
● The HMI device should be switched off immediately and replaced if damaged.
Such damage might be:
– Tears or detachment of individual membranes
– A tear in proximity to the viewing window
Safety instructions and general notes
2.3 Notes about usage
OP 73micro, TP 177micro (WinCC flexible)
22 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
● A label with the following warning must be attached to the inside of the switch
cabinet/cubing at a place that is clearly visible upon opening:
7KLVZDUQLQJGRHVQRWKDYHWREHWDNHQLQWRFRQVLGHUDWLRQ
LI\RXDUHDZDUHWKDWWKHUHLVQRH[SORVLRQKD]DUG
7KHFRQWUROFDELQHWHQFORVXUHLVRQO\DOORZHG
WREHRSHQIRUDVKRUWWLPHHJJUDSKLFGLDJQRVWLFV
,QWKHPHDQWLPH\RXDUHQRWDOORZHGWRSUHVVDVZLWFKSXOORULQVHUW
PRGXOHVDQGGLVFRQQHFWDQ\HOHFWULFOLQHVFRQQHFWRUV
:DUQLQJ
List of approved HMI devices
The list of approved HMI devices is available on the Internet under:
"http://www4.ad.siemens.de/view/cs"
under article ID 13702947.
Further information
The "HMI device in potentially explosive atmospheres of Zone 2 and Zone 22" flyer is part of
the package and must be complied with.
Maintenance
Defective HMI devices must be returned to the manufacturer for repair. Repair may only be
carried out by the manufacturer at his site.
Location of the manufacturer:
Siemens AG
Automation & Drives
Werner-von-Siemens-Straße 50
92224 Amberg
Germany
Approval
Note
HMI devices with approval to II 3 G EEx nA II T4 may only be used on SIMATIC systems of
device category 3.
Safety instructions and general notes
2.4 Electromagnetic compatibility
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 23
2.4 Electromagnetic compatibility
Introduction
The HMI device fulfills requirements of the EMC Directive of the domestic European market
and other requirements.
EMC-compliant installation of HMI devices
An EMC-compliant installation of the HMI device and the use of interference-proof cables
form the basis of trouble-free operation. The "Directives for interference-free installation of
PLCs" and the "PROFIBUS Networks" manual also apply for the installation of the HMI
device.
Pulse-shaped interference
The following table shows the EMC properties of the modules with respect to pulse-shaped
interference. A requirement for this is that the HMI device meets the specifications and
directives regarding electrical installation.
Table 2-1 Pulse-shaped interference
Pulse-shaped
interference
Tested with Corresponds to test
intensity
Electrostatic discharge
conforming to
IEC 61000-4-2
Air discharge: 8 kV
Contact discharge: 4 kV
3
Burst pulses
(high-speed transient
interference)
conforming to
IEC 61000-4-4
2 KV power supply cable
2 KV signal cable, > 30 m
1 KV signal cable, < 30 m
3
High-power surge pulses conforming to IEC 61000-4-5, external protective circuit required (refer to
S7 300 PLC, Installation, chapter “Lightning and overvoltage protection”).
• Asymmetric coupling 2 kV power cable
DC voltage with protective elements
2 KV signal/data cable, > 30 m,
with protective elements as required
3
• Asymmetric coupling 1 kV power cable
DC voltage with protective elements
1 KV signal cable, > 30 m,
with protective elements as required
3
Safety instructions and general notes
2.4 Electromagnetic compatibility
OP 73micro, TP 177micro (WinCC flexible)
24 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Sinusoidal interference
The table below shows the EMC properties of the modules with respect to sinusoidal
interference. A requirement for this is that the HMI device meets the specifications and
directives regarding electrical installation.
Table 2-2 Sinusoidal interference
Sinusoidal interference Test values Corresponds to
test intensity
RF interference
(electromagnetic fields)
• conforming to
IEC 61000-4-3
• conforming to
IEC 61000-4-3
10 V/m with 80 % amplitude modulation of 1 kHz in the
range from 80 MHz to 1 GHz and 1.4 GHz to 2 GHz
10 V/m with 50% pulse modulation at 900 MHz
10 V/m with 50% pulse modulation at 1.89 GHz
3
RF interference current
on cables and cable
shielding conforming to
IEC 61000-4-6
Test voltage 10 V with 80% amplitude modulation of
1 kHz in the range from 9 kHz to 80 MHz
3
Emission of radio interference
Emission of electromagnetic interference conforming to 55011,
Limit value class A, Group 1, measured at a distance of 10 m:
From 30 to 230 MHz < 40 dB (V/m) quasi-peak
From 230 to 1000 MHz < 47 dB (V/m) quasi-peak
Additional measures
Before you connect an HMI device to the public network, ensure that it is compliant with Limit
Class B conforming to 55022.
Safety instructions and general notes
2.5 Transport and storage conditions
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 25
2.5 Transport and storage conditions
Mechanical and climatic transport and storage conditions
The transport and storage conditions of this HMI device exceed requirements conforming to
IEC 61131-2. The following specifications apply to the transport and storage of an HMI
device in its original packing.
The climatic conditions comply to the following standards:
● IEC 60721-3-3, Class 3K7 for storage
● IEC 60721-3-2, Class 2K4 for transport
The mechanical requirements are compliant with EC 60721-3-2, Class 2M2.
Table 2-3 Transport and storage conditions
Type of condition Permissible range
Drop test (in transport package) ≤ 1 m
Temperature from –20° C to +60° C
Atmospheric pressure from 1080 hPa to 660 hPa,
corresponds to an elevation of - 1000 m to 3500 m
Relative humidity from 10% to 90% without condensation
Sinusoidal vibration conforming to
IEC 60068-2-6
5 Hz to 9 Hz: 3.5 mm
9 Hz to 150 Hz: 9.8 m/s2
Shock conforming to IEC 60068-2-29 250 m/s2, 6 ms, 1000 shocks
NOTICE
Ensure that no condensation (dewing) develops on or inside the HMI device after
transporting it at low temperatures or after it has been exposed to extreme temperature
fluctuations.
The HMI device must have acquired room temperature before it is put into operation. Do
not expose the HMI device to direct radiation from a heater in order to warm it up. If dewing
has developed, wait approximately four hours before you switch on the HMI device.
Prerequisite for the trouble-free and safe operation of the HMI device is proper transport and
storage, installation and assembly and careful operation and maintenance.
Warranty for the HMI device is deemed void if these specifications are ignored.
Safety instructions and general notes
2.5 Transport and storage conditions
OP 73micro, TP 177micro (WinCC flexible)
26 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 27
Planning use 3
3.1 Mounting information
Mechanical and climatic conditions of use
The HMI device is intended for installation in weatherproof permanent locations. The
conditions of use are compliant with requirements to DIN IEC 60721-3-3:
● Class 3M3 (mechanical requirements)
● Class 3K3 (climatic requirements)
Use with additional measures
Examples of applications where the use of the HMI device requires additional measures:
● In locations with a high degree of ionizing radiation
● In locations with extreme operating conditions resulting from situations as follows:
– Corrosive vapors, gases, oils or chemicals
– Electrical or magnetic fields of high intensity
● In plants requiring special monitoring features, for example:
– Elevator systems
– Systems in especially hazardous rooms
Mechanical ambient conditions
The mechanical ambient conditions for the HMI device are specified in the following table in
terms of sinusoidal vibration.
Table 3-1 Mechanical ambient conditions
Frequency range
in Hz
Continuous Occasional
10 ≤ f ≤ 58 Amplitude 0.0375 mm Amplitude 0.075 mm
58 ≤ f ≤ 150 0.5 g constant acceleration Constant acceleration 1 g
Planning use
3.1 Mounting information
OP 73micro, TP 177micro (WinCC flexible)
28 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Reduction of vibration
If the HMI device is subjected to greater shocks or vibrations, you must take appropriate
measures to reduce acceleration or amplitudes.
We recommend fitting the HMI device to vibration-absorbent material (on metal shock
absorbers, for example).
Check of mechanical ambient conditions
The following table provides information on the type and scope of the check of mechanical
ambient conditions.
Table 3-2 Check of mechanical ambient conditions
The check
includes
Test standard Remarks
Vibrations Vibration test conforming to
IEC 60068, part 2–6
(sinusoidal)
Type of vibration:
Transitional rate of the frequency:
1 octave/minute.
10 ≤ f ≤ 58,
Constant amplitude 0.075 mm
58 ≤ f ≤ 150,
Constant acceleration 1 g
Vibration duration:
10 frequency cycles per axis in each of the three
axes vertical to each other
Shock Shock test conforming to
IEC 60068, part 2–29
Type of shock: Half-sine
Shock intensity:
Peak value 15 g, duration 11 ms
Direction of impact:
3 shocks in ± direction of axis in each of the
three axes vertical to each other
Planning use
3.1 Mounting information
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 29
Climatic ambient conditions
The HMI device may be used under the following climatic ambient conditions:
Table 3-3 Climatic ambient conditions
Ambient conditions Permissible range Remarks
Temperature
• Vertical mounting
• Inclined mounting
from 0° C to 50° C
from 0 °C to 40 °C
See the "Mounting positions and type of
fixation" section
Relative humidity 10% to 90% Without condensation, corresponds to a
relative humidity, stress class 2
conforming to IEC 61131, part 2
Atmospheric pressure 1080 hPa to 795 hPa Corresponds to an elevation of -1000 to
2000 m
Pollutant concentration SO2: < 0.5 ppm;
relative humidity < 60%, no
condensation
H2S: < 0.1 ppm;
relative humidity < 60 %, no
condensation
Test: 10 ppm; 4 days
Test: 1 ppm; 4 days
Planning use
3.2 Mounting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
30 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
3.2 Mounting the OP 73micro
3.2.1 Mounting positions and fixation
Mounting position
The HMI device is designed for mounting in racks, switch cabinets, switchboards and
consoles. In the following, all of these mounting options are referred to by the general term
"cabinet."
The HMI device is self-ventilated and approved for vertical and inclined mounting in
stationary cabinets.
–+
Figure 3-1 Approved deviations from the vertical mounting position of the OP 73micro without
auxiliary ventilation
Mounting position Deviation from the vertical
① Inclined ≤ –80°
② Vertical 0°
③ Inclined ≤ 80°
CAUTION
Impermissible ambient temperatures
Do not operate the HMI device without auxiliary ventilation if the maximum permissible
ambient temperature is exceeded. The HMI device may otherwise get damaged and its
approvals and warranty will be void!
Planning use
3.2 Mounting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 31
Type of fixation
Spring clamps are provided for mounting the device. Hook the clamps into the recesses of
the HMI device. The overall HMI device dimensions are not exceeded by this.
1
2
Figure 3-2 View of a mounting clamp
① Hook
② Recessed head screw
3.2.2 Preparing for mounting
HMI mounting location
What to observe when selecting the mounting location:
● Position the HMI device so that it is not subjected to direct sunlight.
● Position the HMI device to provide an ergonomic position for the operator and select a
suitable mounting height.
● Ensure that the air vents are not covered as a result of the mounting.
● Observe the permissible mounting positions for the HMI device.
Preparing the mounting cut-out
The degrees of protection are only guaranteed when the following is observed:
● Material thickness at the mounting cut-out: 2 mm to 4 mm
● The deviation from plane for the panel cut-out is ≤ 0.5 mm.
This condition must be fulfilled for the mounted HMI device.
● Permissible surface roughness in the area of the seal: ≤ 120 µm (Rz 120)
The figure below shows the required mounting cut-out:
138
68
+1
+1
Figure 3-3 Mounting cut-out for OP 73micro
Planning use
3.2 Mounting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
32 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Maintaining clearances
The HMI device must be installed with sufficient clearance:
5050
1515
Figure 3-4 Clearance around the OP 73micro
At least 10 mm clearance is required at the rear.
NOTICE
Ensure that the maximum ambient temperature is not exceeded when mounting the device
in a cabinet and especially in a closed enclosure.
Planning use
3.3 Mounting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 33
3.3 Mounting the TP 177micro
3.3.1 Mounting positions and fixation
Mounting position
The HMI device is designed for mounting in racks, cabinets, control boards and consoles. In
the following, all of these mounting options are referred to by the general term "cabinet."
The HMI device is self-ventilated and approved for vertical and inclined mounting in
stationary cabinets.
–+
Figure 3-5 Permitted mounting positions
Mounting position Deviation from the vertical
① Inclined ≤ –35°
② Vertical 0°
③ Inclined ≤ 35°
CAUTION
Impermissible ambient temperatures
Do not operate the HMI device without auxiliary ventilation if the maximum permissible
ambient temperature is exceeded. The HMI device may otherwise get damaged and its
approvals and warranty will be void!
Planning use
3.3 Mounting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
34 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Horizontal mounting
When mounted horizontally, the cable inlets are located at the bottom.
Vertical mounting
When mounted vertically, the cable inlets are on the right.
Type of fixation
Spring clamps are provided for mounting the device. Hook the clamps into the recesses of
the HMI device. The overall HMI device dimensions are not exceeded by this.
1
2
Figure 3-6 View of a mounting clamp
① Hook
② Recessed head screw
Planning use
3.3 Mounting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 35
3.3.2 Preparing for mounting
Select the HMI device mounting location
What to observe when selecting the mounting location:
● Position the HMI device so that it is not subjected to direct sunlight.
● Position the HMI device to provide an ergonomic position for the operator and select a
suitable mounting height.
● Ensure that the air vents are not covered as a result of the mounting.
● Observe the permissible mounting positions for the HMI device.
Preparing the mounting cut-out
The degrees of protection are only guaranteed when the following is observed:
● Material thickness at the mounting cut-out: 2 mm to 6 mm
● The deviation from plane for the panel cut-out is ≤ 0.5 mm
This condition must be fulfilled for the mounted HMI device.
● Permissible surface roughness in the area of the seal: ≤ 120 µm (Rz 120)
The figure below shows the required mounting cut-out:
198
142
–1
–1
Figure 3-7 Mounting cut-out for the HMI device
Planning use
3.3 Mounting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
36 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Maintaining clearances
The following clearance is required around the HMI device in order to its ensure self-
ventilation:
Figure 3-8 Clearance around the HMI device
At least 10 mm clearance is required at the rear.
NOTICE
Ensure that the maximum ambient temperature is not exceeded when mounting the device
in a cabinet and especially in a closed enclosure.
Planning use
3.4 Information on insulation tests, protection class and degree of protection
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 37
3.4 Information on insulation tests, protection class and degree of
protection
Test voltages
Insulation strength is demonstrated in the type test with the following test voltages
conforming to IEC 61131-2:
Table 3-4 Test voltages
Circuits with a nominal voltage of Ue to other
circuits or ground
Test voltage
< 50 V 500 V DC
Class of protection
Protection Class I conforming to IEC 60536, i.e. grounding conductor to profile rail required!
Protection from foreign objects and water
Degree of protection conforming to
IEC 60529
Explanation
Front panel
Rear panel
IP65 in mounted state
IP20
protection against contact with standard test probes
There is no protection against ingress by water.
The degree of protection provided by the front side can only be guaranteed when the
mounting seal lies completely against the mounting cut-out.
NOTICE
Degree of protection IP65
The degrees of protection are only guaranteed when the following is observed:
• The material strength at the mounting cut-out is at least 2 mm.
• The deviation from the plane of the mounting cut-out in an installed HMI device is
≤ 0.5 mm.
Planning use
3.5 Nominal voltages
OP 73micro, TP 177micro (WinCC flexible)
38 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
3.5 Nominal voltages
The following table shows the permitted nominal voltage and the corresponding tolerance
range.
Table 3-5 Permitted nominal voltages
Nominal voltage Tolerance range
+24 V DC 20.4 V to 28.8 V (–15%, +20%)
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 39
Mounting and connection 4
4.1 Checking the package contents
Check the package contents for visible signs of transport damage and for completeness.
NOTICE
Do not install parts damaged during shipment. In the case of damaged parts, contact your
Siemens representative.
Keep the supplied documentation in a safe place. The documentation belongs to the HMI
device and is required for subsequent commissioning.
4.2 Mounting and connecting the OP 73micro
4.2.1 Mounting the HMI device
Requirements
Two mounting clamps from the accessories are required for installation. The mounting seal
must be available on the HMI device. If the mounting seal is damaged, order a replacement
seal.
Mounting
NOTICE
Always mount the HMI device according to the instructions in this manual.
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
40 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Proceed as follows:
1. Check that the mounting seal is fitted on the HMI device.
Do not install the mounting seal turned inside out. This may cause leaks in the mounting
cut-out.
2. Insert the HMI device into the mounting cut-out from the front.
3. Insert the mounting clamps into the recesses on the side of the HMI device.
Adjust and then fasten the clamps.
Figure 4-1 Insert the mounting clamp on the OP 73micro.
4. Tighten the clamps by screwing down the recessed head screw; permitted torque: 0.15
N/m.
NOTICE
Check the fit of the mounting seal on the front. The mounting seal must not protrude
from the HMI device.
Otherwise, repeat steps 1 to 4.
4.2.2 Connecting the HMI device
Requirements
The HMI device must be mounted according to the specifications of these operating
instructions.
Connection sequence
Connect the HMI device in the following sequence:
1. Equipotential bonding
2. Power supply
Perform a power-up test to ensure that the correct polarity of the supply voltage.
3. PLC/configuration computer as necessary
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 41
NOTICE
Connection sequence
Always follow the correct sequence for connecting the HMI device. Failure to do so may
result in damage to the HMI device.
Connecting the cables
When connecting the cables, ensure that you do not bend any of the contact pins.
Secure the connectors with screws.
Always use shielded data cable. Always use standard cables. For further information, refer to
the SIMATIC HMI Catalog ST 80.
The pin assignment of the interfaces is described in the specifications.
See also
Safety instructions (Page 17)
4.2.2.1 Interfaces
The figure below shows the interfaces of the HMI device.
Figure 4-2 Interfaces of the HMI device
① Power supply connector
② RS 485 interface (IF 1B)
③ Chassis ground terminal
See also
Power supply (Page 146)
RS485 (IF 1B) on OP 73micro (Page 146)
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
42 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.2.2.2 Connecting the equipotential bonding circuit
Potential differences
Differences in potential between spatially separated system parts can lead to high equalizing
currents over the data cables and therefore to the destruction of their interfaces. This
situation may arise if the cable shielding is terminated at both ends and grounded at different
system parts.
Potential differences may develop when a system is connected to different mains.
General requirements of equipotential bonding
Potential differences must be reduced by means of equipotential bonding in order to ensure
trouble-free operation of the relevant components of the electronic system. The following
must therefore be observed when installing the equipotential bonding circuit:
● The effectiveness of equipotential bonding increases as the impedance of the
equipotential bonding conductor decreases or as its cross-section increases.
● If two system parts are connected to each other via shielded data lines with shielding
connected to the grounding/protective conductor on both sides, the impedance of the
additionally installed equipotential bonding cables may not exceed 10% of the shielding
impedance.
● The cross-section of a selected equipotential bonding conductor must be capable of
handling the maximum equalizing current. The best results for equipotential bonding
between two cabinets were achieved with a minimum conductor cross-section of 16 mm2.
● Use equipotential bonding conductors made of copper or galvanized steel. Establish a
large-surface contact between the equipotential bonding conductors and the
grounding/protective conductor and protect these from corrosion.
● Terminate the shielding of the data cable on the HMI device flush and near the
equipotential busbar using suitable cable clamps.
● Route the equipotential bonding conductor and data cables in parallel with minimum
clearance between these. See the wiring diagram.
NOTICE
Equipotential bonding conductor
Cable shielding is not suitable for equipotential bonding. Always use the prescribed
equipotential bonding conductors. The minimum cross-section of a conductor used for
equipotential bonding is 16 mm². When you install MPI and PROFIBUS DP networks,
always use cables with a sufficient crosssection since otherwise the interface modules
may be damaged or destroyed.
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 43
Wiring diagram
1
3 3
87
2
65
4
Figure 4-3 Installing the equipotential circuit
① Chassis ground terminal on the HMI device (example)
② Equipotential bonding conductor cross-section: 4 mm2
③ Cabinet
④ Equipotential bonding conductor cross-section: min. 16 mm2
⑤ Ground terminal
⑥ Cable clamp
⑦ Voltage bus
⑧ Parallel routing of the equipotential bonding conductor and data cable
See also
Electromagnetic compatibility (Page 23)
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
44 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.2.2.3 Connecting the PLC
Wiring diagram
The following diagram illustrates the connection between the HMI device and PLC.
S7-200
Figure 4-4 Connection to the PLC
The interfaces are described in the Specifications section.
Note when connecting
NOTICE
Always use the approved cables to connect a SIMATIC S7 PLC.
Standard cables are available for the connection. For further information, refer to the
SIMATIC HMI Catalog ST 80.
See also
Communication via a point-to-point connection (Page 57)
Communication in the network (Page 58)
Interfaces (Page 41)
4.2.2.4 Connecting the configuration computer
Wiring diagram
The figure below illustrates the connection between the HMI device and configuration
computer.
Figure 4-5 Connecting the configuration computer
The interfaces are described in the Specifications section.
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 45
See also
Interfaces (Page 41)
Wiring diagram
The figure below illustrates the connection between the power supply and the HMI device.
Figure 4-6 Connecting the power supply
The interfaces are described in the Specifications section.
Note when connecting
The power terminal block is included in the assembly kit and is designed for conductors with
a maximum cross-section of 1.5 mm2..
Connecting the terminal block
NOTICE
Damage
Pressure on the screwdriver may damage the HMI device socket if the terminal block is
plugged in when you tighten the screws.
Always remove the terminal block to connect the wires.
*1'
DC +24 V
Figure 4-7 Connecting the terminal block
Connect the power supply cables to the terminal block as shown in the figure above. Ensure
that the cables are not crossed. Refer to the label showing the pin-out on the rear of the HMI
device.
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
46 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Polarity reversal protection
The HMI device is equipped with a polarity reversal protection circuit.
Connecting the power supply
CAUTION
Ensure safe electrical insulation of the power supply. Always use power supply modules
that conform to IEC 364-4-41 or HD 384.04.41 (VDE 0100, Part 410).
Always use power supply modules that comply to SELV (Safety Extra-Low Voltage) and
PELV (Protective Extra Low Voltage) standards.
The power supply voltage must always be within the specified range to prevent
malfunctions on the HMI device.
Equipotential bonding
Therefore, wire the 24 V output of the power supply to the equipotential circuit.
See also
Interfaces (Page 41)
4.2.3 Switching on power and testing the HMI device
Procedure – Switching on power and testing the HMI device
Proceed as follows:
1. Plug the terminal block into the HMI device.
2. Switch on the power supply.
After power on, the display lights up and the following dialog appears briefly:
OP 73micro
(2004-xx-xx)
bootloader vx.xx
Figure 4-8 Bootloader display
If the HMI device does not start, it is possible the wires on the terminal block have been
crossed. Check the connected wires and change the connections if necessary. The
Loader opens once the operating system has started.
Loader
Start
Transfer
Figure 4-9 Loader view
Mounting and connection
4.2 Mounting and connecting the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 47
The HMI device automatically sets transfer mode during initial startup if it does no contain
any project data yet. The following dialog appears:
Transfer
Connecting to host.
Figure 4-10 "Transfer" dialog
3. Press ESC
HELP
to cancel the transfer.
Result
The Loader appears again.
Note
When restarting the system, a project may already be loaded on the HMI device. The system
then skips transfer mode and starts the project.
Use the relevant operator control object to close the project.
Further information on this may be available in your plant documentation.
Navigating in the Loader
Button Action
+/–
or
TAB
Press one of these cursor keys to select the next entry in arrow
direction.
ENTER
• The input is confirmed.
• The submenu or dialog shown below opens.
ESC
HELP
• Move back
Returns to the next higher menu layer.
• Cancel transfer mode
Function test
Perform a function test following commissioning. The HMI device is fully functional when one
of the following states is indicated:
● The "Transfer" dialog is displayed.
● The Loader is displayed.
● A project is started.
Switching off the HMI device
Options for switching off the HMI device:
● Switch off the power supply.
● Disconnect the terminal block from the HMI device.
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
48 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.3 Mounting and connecting the TP 177micro
4.3.1 Mounting the HMI device
Requirements
Four mounting clamps from the kit are needed to mount the the HMI device. The mounting
seal must be available on the HMI device. If the mounting seal is damaged, order a
replacement seal. The mounting seal is part of the associated service pack.
Mounting
NOTICE
Always mount the HMI device according to the instructions in this manual.
Proceed as follows:
1. Check that the mounting seal is fitted on the HMI device.
Do not install the mounting seal turned inside out. This may cause leaks in the mounting
cut-out.
2. Insert the HMI device into the mounting cut-out from the front.
3. Insert the mounting clamps into the recesses on the side of the HMI device.
Insert and then fasten all four clamps.
Figure 4-11 Installing the mounting clamp on the HMI device
4. Tighten the clamp by screwing down the recessed head screw; permitted torque: 0.15
Nm.
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 49
NOTICE
Check the fit of the mounting seal on the front. The mounting seal must not protrude
from the HMI device.
Otherwise, repeat steps 1 to 4.
4.3.2 Connecting the HMI device
Requirements
The HMI device must be mounted according to the specifications of these operating
instructions.
Connection sequence
Connect the HMI device in the following sequence:
1. Equipotential bonding
2. Power supply
Perform a power-up test to ensure that the correct polarity of the supply voltage.
3. PLC/configuration computer as necessary
NOTICE
Connection sequence
Always follow the correct sequence for connecting the HMI device. Failure to do so may
result in damage to the HMI device.
Connecting the cables
When connecting the cables, ensure that you do not bend any of the contact pins.
Secure the connectors with screws.
Always use shielded data cable. Always use standard cables. For further information, refer to
the SIMATIC HMI Catalog ST 80.
The pin assignment of the interfaces is described in the specifications.
See also
Safety instructions (Page 17)
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
50 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.3.2.1 Interfaces
The figure below shows the interfaces of the HMI device.
2 31
Figure 4-12 Interfaces of the HMI device
① Chassis ground terminal
② Power supply connector
③ RS 485 interface (IF 1B)
See also
Power supply (Page 146)
RS 485 (IF 1B) on TP 177micro (Page 147)
4.3.2.2 Connecting the equipotential bonding circuit
Potential differences
Differences in potential between spatially separated system parts can lead to high equalizing
currents over the data cables and therefore to the destruction of their interfaces. This
situation may arise if the cable shielding is terminated at both ends and grounded at different
system parts.
Potential differences may develop when a system is connected to different mains.
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 51
General requirements of equipotential bonding
Potential differences must be reduced by means of equipotential bonding in order to ensure
trouble-free operation of the relevant components of the electronic system. The following
must therefore be observed when installing the equipotential bonding circuit:
● The effectiveness of equipotential bonding increases as the impedance of the
equipotential bonding conductor decreases or as its cross-section increases.
● If two system parts are connected to each other via shielded data lines with shielding
connected to the grounding/protective conductor on both sides, the impedance of the
additionally installed equipotential bonding cables may not exceed 10% of the shielding
impedance.
● The cross-section of a selected equipotential bonding conductor must be capable of
handling the maximum equalizing current. The best results for equipotential bonding
between two cabinets were achieved with a minimum conductor cross-section of 16 mm2.
● Use equipotential bonding conductors made of copper or galvanized steel. Establish a
large-surface contact between the equipotential bonding conductors and the
grounding/protective conductor and protect these from corrosion.
● Terminate the shielding of the data cable on the HMI device flush and near the
equipotential busbar using suitable cable clamps.
● Route the equipotential bonding conductor and data cables in parallel with minimum
clearance between these. See the wiring diagram.
NOTICE
Equipotential bonding conductor
Cable shielding is not suitable for equipotential bonding. Always use the prescribed
equipotential bonding conductors. The minimum cross-section of a conductor used for
equipotential bonding is 16 mm². When you install MPI and PROFIBUS DP networks,
always use cables with a sufficient crosssection since otherwise the interface modules
may be damaged or destroyed.
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
52 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Wiring diagram
1
3 3
87
2
65
4
Figure 4-13 Installing the equipotential circuit
① Chassis ground terminal on the HMI device (example)
② Equipotential bonding conductor cross-section: 4 mm2
③ Cabinet
④ Equipotential bonding conductor cross-section: min. 16 mm2
⑤ Ground terminal
⑥ Cable clamp
⑦ Voltage bus
⑧ Parallel routing of the equipotential bonding conductor and data cable
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 53
4.3.2.3 Connecting the PLC
Wiring diagram
The following diagram illustrates the connection between the HMI device and PLC.
RS 485 S7-200
Figure 4-14 Connecting the PLC
The interfaces are described in the Specifications section.
Note when connecting
NOTICE
Always use the approved cables to connect a SIMATIC S7 PLC.
Standard cables are available for the connection. For further information, refer to the
SIMATIC HMI Catalog ST 80.
See also
Communication via a point-to-point connection (Page 57)
Communication in the network (Page 58)
Interfaces (Page 50)
4.3.2.4 Connecting the configuration computer
Wiring diagram
The figure below illustrates the connection between the HMI device and configuration
computer.
Figure 4-15 Connecting the configuration computer
The interfaces are described in the Specifications section.
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
54 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
See also
Interfaces (Page 50)
Wiring diagram
The figure below illustrates the connection between the power supply and the HMI device.
Figure 4-16 Connecting the power supply
Note when connecting
The power terminal block is included in the assembly kit and is designed for conductors with
a maximum cross-section of 1.5 mm2.
Connecting the terminal block
NOTICE
Damage
Pressure on the screwdriver may damage the HMI device socket if the terminal block is
plugged in when you tighten the screws.
Always remove the terminal block to connect the wires.
*1'
DC +24 V
Figure 4-17 Connecting the terminal block
Connect the power supply cables to the terminal block as shown in the figure above. Ensure
that the cables are not crossed. Refer to the label showing the pin-out on the rear of the HMI
device.
Polarity reversal protection
The HMI device is equipped with a polarity reversal protection circuit.
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 55
Connecting the power supply
CAUTION
Ensure safe electrical insulation of the power supply. Always use power supply modules
that conform to IEC 364-4-41 or HD 384.04.41 (VDE 0100, Part 410).
Always use power supply modules that comply to SELV (Safety Extra-Low Voltage) and
PELV (Protective Extra Low Voltage) standards.
The power supply voltage must always be within the specified range to prevent
malfunctions on the HMI device.
Equipotential bonding
Therefore, wire the 24 V output of the power supply to the equipotential circuit.
See also
Interfaces (Page 50)
4.3.3 Switching on power and testing the HMI device
Procedure
Proceed as follows:
1. Plug the terminal block into the HMI device.
2. Switch on the power supply.
The display lights up after power on. A progress bar is shown during startup.
If the HMI device does not start, it is possible the wires on the terminal block have been
crossed. Check the connected wires and change the connections if necessary. The
Loader opens once the operating system has started.
Figure 4-18 Loader view
Mounting and connection
4.3 Mounting and connecting the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
56 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
The HMI device automatically switches to "Transfer" mode during initial startup if no
project is already loaded on the device. The following dialog appears:
Figure 4-19 "Transfer" dialog
3. Touch "Cancel" to stop the transfer.
Result
The Loader appears again.
Note
When restarting the system, a project may already be loaded on the HMI device. The system
then skips "Transfer" mode and starts the project.
Use the relevant operator control object to close the project.
Further information on this may be available in your plant documentation.
Function test
Perform a function test following commissioning. The HMI device is fully functional when one
of the following states is indicated:
● The "Transfer" dialog is displayed.
● The Loader is displayed.
● A project is started.
Switching off the HMI device
Options for switching off the HMI device:
● Switch off the power supply.
● Disconnect the terminal block from the HMI device.
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 57
4.4 Communication with S7-200
Introduction
This section is intended for configuration engineers of the HMI device.
The following chapter contains information necessary for configuring:
● Connection options to the PLC
● Communication using WinCC flexible
4.4.1 Topologies
Introduction
The HMI device and PLC can communicate using a PtP connection or within a network.
The HMI device can communicate only with one S7-200 at a time.
4.4.1.1 Communication via a point-to-point connection
In a PtP connection, the HMI device is the only device which is connected directly with the
S7-200. You need an MPI cable or a PROFIBUS bus cable with two PROFIBUS bus
connection plugs to connect the HMI device to the PLC.
Figure 4-20 Point-to-point connection
See also
Connecting the PLC (Page 44)
Connecting the PLC (Page 53)
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
58 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.4.1.2 Communication in the network
Introduction
A network consists of several nodes which are connected to the same bus cable and
communicate with each other. All nodes are assigned a unique network address. Which
devices communicate with each other is defined when the devices are configured.
A network must contain a master station and active nodes and may contain slave stations
and passive nodes. The master actively transmits requests to other devices and can also
respond to requests from other masters. A slave only responds to requests.
You need a PROFIBUS bus cable with PROFIBUS bus connector to install a network.
The HMI device always operates as master station.
The HMI device can communicate only with one S7-200 within the network.
S7-200 as active or passive node
The S7-200 station may be operated on the network in master mode (PPI/master mode) and
in slave mode (PPI/slave mode). The default setting of the S7-200 station is PPI/slave mode.
The OP 73micro and TP 177micro can communicate with a SIMATIC S7-200 in PPI/slave
mode and with a SIMATIC S7-200 in PPI/master mode. The HMI device can be connected
via the CPU interface of the SIMATIC S7-200.
Configuration example:
S7-200 -1
1
3
S7-200 -2
2
Figure 4-21 Configuration example for communication in the network
① The active S7-200-1 (in PPI/master mode) outputs requests to the S7-200-2 station.
② OP 73micro communicates with the S7-200-1 in PPI/master mode.
③ TP 177micro communicates with the S7-200-2 in PPI/slave mode.
④ PG to S7-200-1 or S7-200-2, for example, with control tags
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 59
Several HMI devices on one S7-200
An S7-200 PLC supports the connection of up to three HMI devices per CPU interface. The
DP interface of a CPU215-2DP supports the connection of up to five HMI devices.
Configuration example:
Figure 4-22 Three HMI devices on one S7-200
See also
Connecting the PLC (Page 44)
Connecting the PLC (Page 53)
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
60 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.4.1.3 Configuration instructions
Please observe the following configuration instructions:
Note
For a first-generation SIMATIC S7-200 (CPU 214, 215, 216), use the connection at Port 1 for
communication via MPI/PROFIBUS DP. When using a CPU 214, set a baud rate of
9.6 Kbps.
Note
A cable must be terminated with its characteristic wave impedance. To do this, enable the
terminating resistor on the first and last node of the PROFIBUS/MPI network.
Both nodes must be supplied with power. Of the first and last end nodes of a
PROFIBUS/MPI network, only one can be an HMI device! No other HMI devices should be
connected to the network as terminal nodes.
The RS485 PROFIBUS terminal and the PROFIBUS connector are equipped with a switch
for setting the terminating resistor. Meaning of the ON and OFF switch settings:
OFF: The terminating resistor is disabled, i.e. the bus segment is not terminated.
ON: The terminating resistor is enabled, i.e. the bus segment is terminated.
4.4.2 Configuring communication
Requirements
The following software components are required for communication:
● WinCC flexible configuration software
● STEP 7 MicroWIN configuration software for the SIMATIC S7-200 controller
Driver for the HMI device
The communication driver for S7-200 is supplied with WinCC flexible are installed
automatically.
No special blocks are required in the PLC.
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 61
4.4.2.1 Configuring protocol parameters
Parameters to be set
To set the parameters, double-click "Communication ▶ Connections" in the WinCC flexible
project screen of the HMI device. From the "Communications driver" column of the working
area, select the value "SIMATIC S7-200." Then system automatically writes the default
values of the protocol parameters to the properties dialog. You can now customize the
protocol parameters of your configuration:
Figure 4-23 Creating an S7-200 connection
Device-specific parameters
Set the network parameters for the HMI device under "HMI device." The setting applies to all
communication partners.
● "Interface"
Select the IF1 B interface.
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
62 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
● "Baudrate"
Set the data baud rate for the network here. The baud rate is determined by the slowest
HMI device connected to the network. Possible baud rates for the HMI devices
OP 73micro and TP 177micro:
– 9.6 Kbps
– 19.2 Kbps
– 187.5 Kbps
The setting must be identical throughout the network.
● "Address"
Set the address of the HMI device here. The address must be unique within the network.
● "Only master on the bus"
na
Network parameters
In the "Network" tab, set the parameters of the network which contains the HMI device.
● "Profile"
Set "MPI" here.
Select "DP" if you need a baud rate of 9.6 Kbps.
● "Highest station address"
Set the highest station address. The highest station address must be equal to or higher
than the highest actual address. The setting must be identical throughout the network.
● "Number of masters"
Set the number of masters operating in the network. HMI devices must be operated in
master mode. The S7-200 may be operated in master mode.
Communication partners
Under "PLC", assign an address to the S7-200 which is to communicate with the HMI device.
● "Address"
Here, set the address of the S7 module (CPU) that is connected to the HMI device.
● "Slot"
This parameter is not necessary.
● "Rack"
This parameter is not necessary.
● "Cyclic operation"
This parameter is not necessary.
Addressing the SIMATIC S7 PLC
The address of your S7-200 PLC is configured using the STEP 7 MicroWIN tool.
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 63
4.4.3 User data areas
4.4.3.1 Communication between HMI device and controller
Communication principle
The HMI device and the S7–200 controller communicate using
● tags and
● user data areas
Tags
The controller and the HMI device exchange data using process values. During
configuration, tags are created pointing to addresses in the PLC. The HMI device reads the
value from the specified address and displays it. The operator can also make an input on the
HMI device that is then written to the address on the controller.
user data areas
In the case of the OP 73micro and TP 177micro, the user data area serves for transmitting
the date and time from the PLC to the HMI device.
User data areas are set up when you create the project in the project window in
WinCC flexible of the HMI device by selecting "Communication ▶ Connections" in the "Area
pointers" work area. Physically, the user data area is in the PLC.
4.4.3.2 Permitted data types
Permitted data types
The table below lists the data types you may use in the configuration of tags and area
pointers.
Table 4-1 Permitted data types
Name Object Data type
Tag V CHAR, BYTE, INT, WORD, DINT, DWORD, REAL, BOOL,
STRINGCHAR
Input I CHAR, BYTE, INT, WORD, DINT, DWORD, REAL, BOOL,
STRINGCHAR
Output Q CHAR, BYTE, INT, WORD, DINT, DWORD, REAL, BOOL,
STRINGCHAR
Flag M CHAR, BYTE, INT, WORD, DINT, DWORD, REAL, BOOL,
STRINGCHAR
Timer T Timer
Counter C INT
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
64 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.4.3.3 Time synchronization via area pointer
Introduction
When the "Date/Time PLC" area pointer is configured, the HMI device reads the date and
time cyclically from the PLC. The position of the "Date/Time PLC" user data area is defined
in the area pointer.
Procedure
To configure the address of the area pointer, select "Communication ▶ Connection", then
select "Area pointer."
Figure 4-24 Creating an area pointer
● Connection
Name of the connection
● Name
Default name of the area pointer set by WinCC flexible.
● Address
Enter the tag address of the area pointer In the PLC here.
● Length
The default length of the area pointer is set by WinCC flexible.
● Acquisition cycle
Here, define an acquisition cycle to enable the HMI device to read an area pointer
cyclically. Make allowances for the fact that a shorter acquisition time may have a
negative influence on HMI device performance.
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 65
● Comment
This is where you can save a comment which describes the use of the area pointer, for
example.
Function
The PLC describes the data area of the "Date/Time PLC" area pointer. All specifications are
coded in BCD format.
The HMI device reads the data cyclically based on the configured acquisition cycle and
synchronizes itself.
Note
Do not configure an extremely short acquisition cycle for the date/time area pointer because
this will have a negative influence on HMI device performance.
Recommendation: Acquisition cycle of 1 minute, if the process allows this.
The HMI device time has a resolution of seconds, regardless of the acquisition cycle.
The date/time data area has the following structure:
DATE_AND_TIME format (in BCD code)
Most significant byte Least significant byte Data word
7 . . . . . . 0 7 . . . . . . 0
n+0 Year (80-99/0-29) Month (1-12)
n+1 Day (1-31) Hour (0-23)
n+2 Minute (0-59) Second (0-59)
n+3 Reserved Reserved Weekday
(1-7, 1=Sunday)
n+4 Reserved Reserved
n+5 Reserved Reserved
Note
Note that when you set a Year value, the system sets the years 1980 through 1999 when 80
to 99 is set and the years 2000 through 2029 when 0 to 29 is set.
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
66 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
4.4.3.4 Mechanism of error alarm acknowledgment
Introduction
Alarms indicate the process and plant states on the HMI device.
Alarms are configured in WinCC flexible. Each alarm is assigned an alarm bit in the PLC.
Each alarm bit must be a tag or tag element which is configured in WinCC flexible.
Various alarm classes are available. Alarms of the "Error" class must be acknowledged
because of their importance.
The following distinctions are made for acknowledgments:
● Acknowledgment on the HMI device
● Acknowledgment by the PLC
Acknowledgment by the PLC
Acknowledgment of error alarms by the PLC requires the "Write acknowledgment tag"
function to be configured.
When "Write acknowledgment tag" is set in the PLC, the system automatically acknowledges
the corresponding error alarm. This function is identical to the acknowledgment function on
the HMI device, for example, triggered with the "ACK" button.
The "Write acknowledgment tag" bit and the alarm bit must be set in the tag.
Reset the acknowledgment bit before the alarm bit is set again in the error alarm area. The
figure below shows the pulse diagram.
1HZ
HUURUDODUP
5HVHWRI
DFNQRZOHGJP
ELW
$FNQRZOHGJP
YLD3/&
$UULYDORIWKH
HUURUDODUP
$FNQRZOHGJPHQW
3/&ᇪ+0,GHYLFH
(UURUDODUP
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 67
Acknowledgment on the HMI device
The PLC can only detect an error alarm acknowledgment at the HMI device if the "Read
acknowledgment tag" bit is configured. The HMI device sets the "Read acknowledgment tag"
bit in the PLC after it has acknowledged an alarm.
In order to generate a signal transition each time the acknowledgment bit is set, the HMI
device initially resets the corresponding "Read acknowledgment tag" bit when an error alarm
bit is set. There is a certain time-based offset between these two operations due to the
processing time of the HMI device.
The figure below shows the pulse diagram.
1HZ
HUURUDODUP
$FNQRZOHGJP
YLD+0,GHYLFH
5HVHWRI
DFNQRZOHGJPELW
$UULYDORIWKH
HUURUDODUP
$FNQRZOHGJPHQW
+0,GHYLFHᇪ3/&
(UURUDODUP
See also
Overview (Page 127)
Acknowledging an Alarm (Page 134)
Acknowledging an Alarm (Page 131)
Mounting and connection
4.4 Communication with S7-200
OP 73micro, TP 177micro (WinCC flexible)
68 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 69
Operator control components and LEDs 5
5.1 Front side operator control components and indicators on the OP
73micro
1
2
Figure 5-1 Operator control components and LEDs
① Soft keys
② System keys – control keys
Standard input device at the HMI device is the keyboard. This is basically composed of two
key groups:
● Soft keys
F1 to F4
The soft keys can only be assigned within a project and do not have any function in the
Loader menu.
● System keys
These include the control keys, for example.
NOTICE
Unintentional actions
Unwanted actions may be triggered if the operator unintentionally actuates several keys
at once.
Never press more than two keys simultaneously.
Keyboard damage
Operation of the keys with hard, pointed or sharp objects or hard impact may lead to a
considerable reduction of the service life and even to complete failure.
Always use your fingers to operate the keys of your HMI device.
Operator control components and LEDs
5.2 Front side operator control components and LEDs on the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
70 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
See also
Design of the OP 73micro HMI device (Page 12)
5.2 Front side operator control components and LEDs on the TP 177micro
1
Figure 5-2 Operator control components
① Display with touch screen
Standard input unit at the HMI device is the touch screen. All operator control objects
required for operator input are displayed on the touch screen once the HMI device has
started.
NOTICE
Unintentional actions
Never touch more than one point on the display. Never touch more than one touch object at
a time, otherwise you may trigger unintentional actions.
Damaging the touch screen
The use of with hard, sharp or pointed items or applying excessive pressure when
operating the touch screen will substantially reduce its useful life and even lead to total
failure.
Always operate the HMI device touch screen with your fingers or with a touch pen.
See also
Design of the TP 177micro HMI device (Page 13)
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 71
Configuring the operating system 6
6.1 Configuring the operating system for the OP 73micro
6.1.1 Overview
Loader
The figure below shows the Loader. It appears briefly when the HMI device starts up.
Loader
Start
Transfer
Info/Settings
Figure 6-1 Loader
The Loader menu commands have the following functions:
● "Transfer"
Select this menu command to set the HMI device transfer mode.
● "Start"
Select this menu command to start the project which is stored on the HMI device.
● "Info/Settings"
Select this menu command to open the HMI device configuration menu.
The Loader also appears when you close the project.
Navigating in the Loader
Button Action
+/–
or
TAB
By pressing one of these buttons, you select the next menu command
in the direction of the cursor key.
ENTER
The corresponding menu opens.
ESC
HELP
Returns to the next higher menu layer.
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
72 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Editing dialog entries
Button Action
+/–
or
TAB
Selects the previous or next list entry.
ENTER
The selected list entry is accepted.
ESC
HELP
You can undo your input as long you have not yet confirmed the
selected list entry with
ENTER
.
See also
Switching on power and testing the HMI device (Page 46)
6.1.2 "Info/Settings" menu
6.1.2.1 Overview
Requirements
"Info/Settings" was called in the Loader.
"Info/Settings" menu
Info/Settings
Device Info
Contrast
Logon/Settings
Version Info
Figure 6-2 "Info/Settings" menu
"Contrast" Menu command for setting the display contrast
"Device Info" Menu command with information on the HMI device
"Version Info" Menu command with information on the version of the HMI device image
"Logon/Settings" Menu command of the "Logon/Settings" menu
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 73
Password protection
You can protect the "Logon/Settings" menu from unauthorized access by assigning a
password.
This prevents inadvertent wrong operation and increases security for the plant or machine
security because access to the settings is denied. If the user does not enter a password, this
user can only access the "Contrast", "Device Info" and "Version Info" menu commands.
When a password is assigned, the following dialog appears when the user attempts to open
the "Logon/Settings" menu:
Password |
Figure 6-3 Password dialog
You need to enter the password again to access the "Logon/Settings" menu after you closed
the previous session.
NOTICE
Password no longer available
If the Loader password is no longer available, you can only call the "Logon/Settings" menu
again after you update the operating system.
All data on the HMI device will be overwritten when you update the operating system.
Note
The currently active entry is always indicated in a dialog.
See also
Assigning, editing and deleting passwords (Page 77)
Updating the operating system using WinCC flexible (Page 101)
Updating the operating system in ProSave (Page 102)
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
74 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
6.1.2.2 Setting screen contrast
Requirements
"Info/Settings ▶ Contrast" was selected from the Loader menu.
Principle
Contrast
change contrast.
Press Up/Down to
Figure 6-4 "Contrast" dialog
This dialog is used to adjust the contrast and therefore indirectly controls screen brightness.
NOTICE
Screen contrast
The screen contrast can be increased and reduced within a wide range. Note that this may
lead to the screen content becoming unrecognizable under unfavorable lighting conditions.
+/–
reduces the contrast and
TAB
increases the contrast.
6.1.2.3 Displaying information about the HMI device
Requirements
"Info/Settings ▶ Device Info" was selected from the Loader menu.
Principle
Figure 6-5 "Device Info" dialog
This dialog is used to indicate the name of the HMI device ("Device") and the size of internal
Flash memory ("Flashsize"). The Flash memory is used to store the HMI device image and
project data. The size of the internal Flash memory does not correspond to the available
working memory for a project. This dialog is read only.
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 75
6.1.2.4 Viewing information about the version of the HMI device image
Requirements
"Info/Settings ▶ Version Info" was selected from the Loader menu.
Principle
Version Info
BL 0.17/2004-xx-xx
01.00.00.00_05.08
Figure 6-6 "Version Info" dialog – Example
The "Version Info" dialog shows information on the Bootloader and the HMI device image file
and therefore the version of the operating system.
This information is required when you contact A&D Technical Support.
6.1.3 "Settings" menu
6.1.3.1 Overview
Requirement
"Info/Settings ▶ Logon/Settings" was selected from the Loader menu. You have entered the
password for the "Settings" menu.
"Settings" menu
Settings
Startup Delay
Screensaver
---------------
Figure 6-7 "Settings" menu
"Startup Delay" Menu command for setting the startup delay on the HMI device
"Screen Saver" Menu command for the screen saver
"Password" Menu command for the password
"Transfer Settings" Menu command for transfer settings
Select the "Settings" menu to edit the system settings for your HMI device.
Access to this menu can be protected by a password.
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
76 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Procedure
Proceed as follows:
1. Close the project.
2. Open the "Logon/Settings" menu.
3. Edit the settings.
4. Close the "Logon/Settings" menu.
6.1.3.2 Setting the delay
Requirements
"Info/Settings ▶ Logon/Settings ▶ Startup Delay" was selected from the Loader menu.
Principle
Startup Delay
Value: Sec.3
Figure 6-8 "Startup Delay" dialog
The delay defines the period which the HMI device automatically delays the startup of a
stored project.
When the value "0" is set, the project starts immediately. It is then no longer possible to call
the Loader after switching on the HMI device. To handle this situation, you must have
configured an operator control object you can use to close the project.
Valid range of values: 0 s to 60 s.
6.1.3.3 Setting the screen saver
Requirement
"Info/Settings ▶ Logon/Settings ▶ Screen saver" was selected from the Loader menu.
Principle
Screensaver
Value: Min.
0
Figure 6-9 "Screen saver" dialog
Use this dialog to set the activation delay for the screen saver.
Valid range of values: 5 min to 360 min. The screen saver is disabled when you set 0.
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 77
6.1.3.4 Assigning, editing and deleting passwords
Introduction
To restrict access to the "Settings" menu to specific members of staff, define a password in
the "Password" dialog.
Requirements
● "Info/Settings ▶ Logon/Settings ▶ Password" was selected from the Loader menu.
● The "Password" dialog opens.
Password |
Figure 6-10 "Password" dialog
Procedure – Assigning and editing passwords
Proceed as follows:
1. Enter the password.
Select the first character with
TAB
or
+/–
. Press
INS
to enter additional characters.
Note
Password entry
The last character of the password entered is shown in plain text. The remaining
characters are represented by a ∗ character.
2. Press
ENTER
You have now completed entry of the password. The "Confirm Password" dialog appears.
Confirm Password
|
Figure 6-11 "Confirm Password" dialog
You need to enter the password twice to confirm it.
1. Enter the password again.
2. Press
ENTER
,
You have now completed the password confirmation. The password is accepted if both
password entries are identical. Otherwise, an error message appears. The "Settings"
menu opens. Repeat the password input.
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
78 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Result
● The "Settings" menu opens.
● The "Settings" menu is password protected.
Procedure – Deleting a password
Proceed as follows:
1. Press
ENTER
– do not enter any other characters.
The "Confirmation" dialog opens.
2. Press
ENTER
– do not enter any other characters.
The system confirms the deletion.
Result
● The "Settings" menu opens.
● You have revoked the password protection of the "Settings" menu.
See also
Overview (Page 72)
Configuring the operating system
6.1 Configuring the operating system for the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 79
6.1.3.5 Configure the data channel
Introduction
By disabling a data channel, you can protect the HMI device from unintentional overwriting of
project data and of the HMI device image.
Requirements
"Info/Settings ▶ Logon/Settings ▶ Transfer Settings" was selected from the Loader menu.
Tran sfe r Setting s
Channe l1: Se rial
Figure 6-12 "Transfer Settings" menu
Procedure
1. Press
ENTER
.
The "Channel1: Serial" dialog opens.
Channel 1: serial
Value: Enable
Figure 6-13 "Channel1: Serial" dialog
This dialog is used to configure the RS495 port for serial data transfer.
1. Select the relevant setting using the
TAB
and
+/–
cursor keys.
– "Disable"
Serial data transfer is disabled.
– "Enable"
Serial data transfer is enabled.
2. Accept the required value with
ENTER
.
Note
Transfer settings
The data channel must be enabled to allow the download of project data from the
configuration computer to the HMI device.
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
80 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
6.2 Configuring the operating system for the TP 177micro
6.2.1 Overview
Loader
The figure below shows the Loader. It appears briefly when the HMI device starts up.
Figure 6-14 HMI device Loader
The Loader buttons have the following functions:
● Use the "Transfer" button to set "Transfer" mode on the HMI device.
● Press the "Start" button to open the project stored on the HMI device.
● Press "Control Panel" to open the HMI device Control Panel.
The Control Panel is used to configure various settings such as the transfer settings.
The Loader also appears when you close the project.
Password protecting the Control Panel
You can protect the Control Panel from unauthorized access. You can read the settings in
the Control Panel without entering a password but you cannot edit all settings.
This prevents inadvertent wrong operation and increases security for the plant or machine
security because access to the settings is denied.
NOTICE
If the Control Panel password is no longer available, you cannot change settings in the
Control Panel unless you update the operating system.
All data on the HMI device will be overwritten when you update the operating system.
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 81
See also
Switching on power and testing the HMI device (Page 55)
6.2.2 Control Panel
6.2.2.1 Overview
Control Panel of the HMI device
The HMI device Control Panel can be used to modify the following HMI device settings:
● Screen settings
● Transfer settings
Opening the Control Panel
Open the Control Panel using the HMI device Loader.
The following options are available to open the Loader:
● The Loader appears briefly after starting the HMI device.
● During runtime:
If configured, touch the relevant operator control object to stop the project. The Loader is
displayed. Further information on this may be available in your plant documentation.
Touch the "Control Panel" button in the Loader to open the HMI device Control Panel.
Figure 6-15 HMI device Control Panel
"OP" Change screen settings, display information on HMI device, calibrate touch
screen
"Password" Set password protection for the Control Panel
"Screen Saver" Configuring the screen saver
"Transfer" Configure the data channel
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
82 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
General Procedure
Proceed as follows to change settings in the Control Panel:
1. You must exit the project before changing settings in the Control Panel. Use the relevant
operator control object provided in the project.
2. Open the Control Panel as described above.
3. To change settings, touch the respective input field or check box and use the displayed
screen keyboard if necessary. Enter the required password if the Control Panel is
protected against unauthorized access. Change the HMI device settings in the Control
Panel.
Close the Control Panel: Touch the button.
4. Start the project using the Loader.
6.2.2.2 Changing screen settings
Requirements
The "OP" icon on the Control Panel has been touched.
Procedure
Proceed as follows:
1. From the "OP Properties" dialog, select the "Display" tab.
1
2
3
4
Figure 6-16 "OP Properties" dialog, "Display" tab
① Button for increasing the contrast
② Button for reducing contrast
③ Screen orientation settings
④ Input field for the delay time at the startup of the HMI device
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 83
2. The "Contrast" group contains the "UP" and "DOWN" buttons. To adjust the screen
contrast:
– Touch the "UP" button to increase screen contrast.
– Touch the "DOWN" button to reduce screen contrast.
3. The "Orientation" group contains the "Landscape" and "Portrait" buttons. To adjust the
screen orientation:
– Set the "Landscape" check box to set the HMI device screen for horizontal orientation.
– Set the "Portrait" check box to set the HMI device screen for vertical orientation.
4. The "Startup Delay" group contains the "Delay time" input field you can use to adjust the
delay at the startup of your HMI device. The delay represents the interval in seconds
which expires between the appearance of the Loader and start of the project.
When the value "0" is set, the project starts immediately. It is then no longer possible to
call the Loader after switching on the HMI device. To handle this situation, you need to
configure an operator control object with "Close project" function.
The valid value range is 0 s to 60 s.
5. Close the dialog and save your entries with . Touch to discard the values.
Result
You have completed your HMI device screen settings.
Screen orientation
The orientation of the screen is determined by the configuration engineer when he creates
the project. When the project is transferred to the HMI device, the appropriate screen
orientation is set automatically.
NOTICE
If there is a project on the HMI device, do not change the screen orientation.
You can change the screen orientation in the Control Panel, for example, if you have to
operate the Loader on a vertically installed HMI device without the project.
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
84 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
6.2.2.3 Displaying information about the HMI device
Requirements
You have touched the "OP" icon on the Control Panel.
Procedure
Proceed as follows:
1. Open the "OP Properties" dialog and select the "Device" tab.
1
2
3
4
5
Figure 6-17 "OP Properties" dialog, "Device" tab – example
① HMI device name
② Version of the HMI device image
③ Version of the boot loader
④ Boot loader release date
⑤ The Flash memory is used to store the HMI device image and project data.
2. The "Device" tab is used to display specific HMI device information. There are no input
options.
This information is required when you contact A&D Technical Support.
3. Use or to close the dialog when the information is no longer required.
Note
The size of the internal Flash memory does not correspond to the available working
memory for a project.
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 85
6.2.2.4 Calibrating the touch screen
Introduction
Depending on the mounting position and viewing angle, it is possible that parallax may occur
when operating the HMI device. In order to prevent any operating errors as a result, calibrate
the screen again in the startup phase or during runtime.
Requirements
The "OP" icon on the Control Panel has been touched.
Procedure
Proceed as follows:
1. Open the "OP Properties" dialog, then select the "Touch" tab.
1
2
Figure 6-18 "OP Properties" dialog, "Touch" tab
① If the HMI device does not react precisely to a touch, the touch screen may require
calibration.
② Button for calibrating the touch screen
2. Touch the "Recalibrate" button.
3. Follow the instructions on the HMI device screen.
4. Close the dialog with .
Result
The HMI device touch screen is now recalibrated.
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
86 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
6.2.2.5 Changing the password setting for the Control Panel
Requirements
The "Password" icon in the Control Panel has been touched.
The "Password Properties" dialog is shown.
1
2
Figure 6-19 "Password Properties" dialog
① Password input field
② Input field for entering the password a second time
Procedure – Entering a password
Proceed as follows:
1. Enter a password in the "Password" input field.
Touch the input field. The alphanumerical screen keyboard is displayed.
2. Repeat the password entry in the "Confirm Password" input field.
3. Close the dialog with .
NOTICE
The password may not contain space characters or the special characters * ? . % / \ ' ".
Result
The Control Panel is protected from unauthorized access. Without entering a password, you
can read some settings but you cannot change them.
NOTICE
If the Control Panel password is no longer available, you cannot change settings in the
Control Panel unless you update the operating system.
All data on the HMI device will be overwritten when you update the operating system.
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 87
Procedure – Deleting a password
Proceed as follows:
1. Delete the entries for "Password" and "Confirm Password".
2. Close the dialog with .
Result
Password protection for the Control Panel menu is revoked.
See also
Overview (Page 80)
6.2.2.6 Setting the Screen Saver
Introduction
You can set a period of time for automatic activation of the screen saver on the HMI device.
The screen saver is automatically activated if the HMI device is not operated within the
specified period of time.
The screen saver stops in the following situations:
● When you touch the touch screen.
● A message is displayed.
Requirements
The "Screen Saver" dialog has been opened with the "Screen Saver" icon.
Figure 6-20 "Screen saver" dialog
Procedure
Proceed as follows:
1. Enter the number of minutes before the screen saver is to be activated.
Touch the input field. You can enter a value between 5 and 360 minutes. Entering "0"
deactivates the screen saver.
2. Close the dialog and save your entries with . Touch to discard the entries.
Configuring the operating system
6.2 Configuring the operating system for the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
88 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
NOTICE
Activating the Screen Saver
You should always activate the screen saver. Otherwise, the screen contents may leave
a burn-in effect in the background if they appear too long.
This effect is reversible, however.
Result
The screen saver for the HMI device has now been set.
6.2.2.7 Configure the data channel
Introduction
By disabling a data channel, you can protect the HMI device from unintentional overwriting of
project data and of the HMI device image.
Requirements
You have touched the "Transfer" icon on the Control Panel.
The "Transfer Settings" dialog is displayed.
1
Figure 6-21 "Transfer Settings" dialog
This dialog is used to configure the RS495 port for serial data transfer.
① Group for data channel 1 (Channel 1)
Procedure
Enable the "Channel 1" data channel by setting the "Enable Channel" check box:
● Set the "Enable Channel" check box to enable serial transfer.
● Reset the "Enable Channel" check box to disable serial transfer.
Note
Transfer settings
The data channel must be enabled to allow the download of project data from the
configuration computer to the HMI device.
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 89
Preparing and backing up a project 7
7.1 Overview
Configuration and process management phases
HMI devices can be used to operate and monitor tasks in process and production
automation. The plant screens on the HMI devices are used to provide a clearer overview of
active processes. The HMI device project, which includes the plant screens, is created
during the configuration phase.
Once the project is transferred to the HMI device and the HMI device is connected to a PLC
in the automation system, processes can be operated and monitored in the process
management phase.
&RQQHFWLRQWRWKH3/&
7UDQVIHUWKHSURMHFW
3/&
7HVWWKHSURMHFW
6LPXODWHWKHSURMHFW
6DYHWKHSURMHFW
+0,GHYLFHGHSHQGHQW
+0,GHYLFH 2SHUDWHWKHSURMHFW
&RQILJXUDWLRQSKDVH
3URFHVVFRQWUROSKDVH
&UHDWHSURMHFW
&RQILJXUDWLRQ3&
Figure 7-1 Configuration and process management phases
Preparing and backing up a project
7.1 Overview
OP 73micro, TP 177micro (WinCC flexible)
90 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Transferring the project to the HMI device
The following can be performed to transfer a project to an HMI device:
● Transfer the project from the configuration computer
● Restore the project from a PC using ProSave
In this case, an archived project is transferred from a PC to the HMI device. The
engineering software need not be installed on this PC.
These procedures can be are available for commissioning and recommissioning a project.
Commissioning and recommissioning
● When the HMI device is commissioned there is no project at first.
The HMI device is also in this state after the operating system has been updated.
● When recommissioning, any project on the HMI device is replaced.
7.1.1 Setting the operating mode
Operating modes
Operating modes of the HMI device:
● Offline
● Online
● Transfer
"Offline mode" and "Online mode" can be set on the configuration computer and on the HMI
device. To set these modes on the HMI device, use a corresponding operator control object
of the project.
Changing the operating mode
The configuration engineer must have configured an appropriate operator control object to
allow a change of the operating mode on the HMI device during ongoing operation.
Further information on this may be available in your plant documentation.
"Offline" mode
In this mode, there is no communication between the HMI device and PLC. Although the
HMI device can be operated, it cannot exchange data with the PLC.
"Online" mode
In this mode, the HMI device and PLC communicate. You can operate the plant on the HMI
device according to your system configuration.
Preparing and backing up a project
7.1 Overview
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 91
"Transfer" mode
In this mode, you can transfer a project from the configuration computer to the HMI device or
backup and restore HMI device data, for example.
The following options are available for setting "Transfer" mode on the HMI device:
● When the HMI device starts up
Start "Transfer" mode manually in the HMI device Loader.
● During ongoing operation
Start transfer mode manually within the project using an operator control object.
7.1.2 Reusing existing projects
You can reuse existing projects on the HMI devices.
The following cases are possible:
1. Reusing projects on OP 73micro
Existing OP3 projects can be reused on OP 73micro.
Migrate the OP3 project to WinCC flexible (compact, standard, advanced) into an OP 73
project, then replace your HMI device with the OP 73micro.
2. Reusing existing projects on TP 177micro
– TP 170A project available in ProTool
Migrate the TP 170A project to WinCC flexible (compact, standard, advanced) and
then replace your HMI devices with a TP 177micro.
– TP 170A project available in WinCC
In WinCC flexible (Compact, Standard, Advanced), replace your HMI device with a
TP 177micro.
– TP 170micro project available in WinCC flexible
In WinCC flexible (Compact, Standard, Advanced), replace your HMI device with a
TP 177micro.
Note
Projects for TP 070 can not be reused.
For more information, please see the online help for WinCC flexible or the "WinCC flexible
Migration" user manual.
Preparing and backing up a project
7.2 Transfer
OP 73micro, TP 177micro (WinCC flexible)
92 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
7.1.3 Data Transfer Options
Overview
The following table shows the options for transferring data between the configuration
computer and OP 73micro or TP 177micro.
Type Type OP 73micro TP 177micro
Serial (with reset to factory setting) No No Backup
Serial Yes Yes
Serial (with reset to factory setting) Yes 1) / No 2) Yes
1) / No 2) Restore
Serial No 1) / Yes 2) No
1) / Yes 2)
Serial (with reset to factory setting) Yes Yes Updating the operating
system Serial No No
Serial (with reset to factory setting) No No Transfer of a project
Serial Yes Yes
1) Applies to complete restore
2) Applies to restoring the password list
Serial transmission
You can use one of the following adapters for the serial transmission to the configuration PC:
● RS 232/PPI cable MM Multimaster
● USB/PPI cable MM Multimaster (as of manufacturer version 05 of the cable)
7.2 Transfer
7.2.1 Overview
Transfer
During transfer, the project is downloaded from the configuration computer to the HMI
device.
"Transfer" mode can be started on the HMI device.
Transferred data is written directly to the flash memory on the HMI device. The data channel
must be configured before you start the transfer.
Preparing and backing up a project
7.2 Transfer
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 93
7.2.2 Starting transfer
Introduction
You can set "Transfer" mode manually on the HMI device using a configured operator
control object and during ongoing operation.
Requirements
● The *.hmi project is opened in WinCC flexible.
● The HMI device is connected to a configuration computer.
● The data channel is configured on the HMI device.
● The HMI device Loader is opened.
Procedure
Proceed as follows to initiate the transfer:
1. Switch to "Transfer" mode on the HMI device.
2. Proceed as follows on the configuration computer:
– Select the "Project ▶Transfer ▶Transfer Settings" menu command in WinCC flexible.
– Select the HMI device and define the parameters for the connection.
– Start the download with "Transfer".
The configuration computer verifies its connection to the HMI device. If the connection is
not available or is faulty, the configuration computer outputs an alarm. If no
communication error is detected, the project is transferred to the HMI device.
Result
When the transfer is completed successfully, the data can be found on the HMI device. The
transferred project is then started automatically.
See also
Configure the data channel (Page 88)
Configure the data channel (Page 79)
Setting the operating mode (Page 90)
Data Transfer Options (Page 92)
Preparing and backing up a project
7.2 Transfer
OP 73micro, TP 177micro (WinCC flexible)
94 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
7.2.3 Testing a project
Introduction
There are two options on the HMI device testing a project:
● Offline testing of the project
Offline testing means that communication between the HMI device and PLC is down
while the test is being carried out.
● Online testing of the project
Online testing means that the HMI device and PLC communicate with each other during
testing.
Perform both tests, starting with the "Offline test", followed by the "Online test".
Note
You should always test the project on the HMI device on which the project will be used.
Check the following:
1. Check the correct layout of the screens.
2. Check the screen structure.
3. Check the input objects.
4. Enter the tag values.
The test increases the certainty that the project will run error-free on the HMI device.
Requirements for the offline test
● The project has been transferred to the HMI device.
● The HMI device is in "Offline" mode.
Procedure
In "Offline" mode, you can test the various project functions on the HMI device without them
being affected by the PLC. PLC tags, therefore, are not updated.
Test the operator control objects and visualization of the project as far as possible without
connecting to the PLC.
Requirements of the online test
● The project has been transferred to the HMI device.
● The HMI device is in "Online" mode.
Procedure
In "Offline" mode, you can test the various project functions on the HMI device without them
being affected by the PLC. PLC tags are updated in this case.
Test the operator control objects and views of the project.
See also
Setting the operating mode (Page 90)
Preparing and backing up a project
7.3 Backup and restore
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 95
7.3 Backup and restore
7.3.1 Overview of backup and restoring
Introduction
Data located on the HMI device can be backed up using a PC external to the HMI device
and can be restored from it.
The following data in the internal Flash memory can be backed up and restored:
● Project and HMI device image
● Password list
Backup and restoring can be performed in the following ways:
● WinCC flexible
● ProSave
General notes
NOTICE
Power failure
If an operation for restoring data is interrupted due to power failure on the HMI device, the
operating system of the HMI device may be deleted! The operating system then has to be
updated.
Compatibility conflict
If a message is output on the HMI device warning of a compatibility conflict during the
restore operation, the operating system must be updated.
Preparing and backing up a project
7.3 Backup and restore
OP 73micro, TP 177micro (WinCC flexible)
96 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
7.3.2 Resetting to Factory Settings for Backup and Restore
Reset to factory setting
In ProSave or WinCC flexible, you can perform a restore with or without resetting to factory
settings.
● Restoring the password list without reset to factory setting
First, set "Transfer" mode at the HMI device. Then start the restore in ProSave or
WinCC flexible.
● Restoring all project data and the HMI device image with reset to factory setting
First, start the restore in ProSave or WinCC flexible and then switch the power on the
HMI device off and on again.
Note
Restoring with with reset to factory setting is also possible when the HMI device operating
system is corrupt and you can therefore can no longer run the Loader of the HMI device.
Use the "Reset to factor state" check box in ProSave to determine the restoring procedure.
7.3.3 Backup and Restore via WinCC flexible
Introduction
Backup and restore operations transfer the relevant data between flash memory on the HMI
device and a configuration computer.
Requirement
● The HMI device is connected to a configuration computer.
● No project is open in WinCC flexible.
● Only for restoring the password list or when backing up the data:
The data channel is configured on the HMI device.
Procedure - backup
Proceed as follows:
1. Select the menu command "Project ▶ Transfer ▶ Communication Settings" in WinCC
flexible on the configuration computer.
The "Communication Settings" dialog opens.
2. Select the HMI device type.
3. Select the type of connection between the HMI device and the configuration computer,
then set the communication parameters.
4. Close the dialog with "OK".
Preparing and backing up a project
7.3 Backup and restore
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 97
5. In WinCC flexible, select the menu command "Project ▶ Transfer ▶ Backup".
The "Backup Settings" dialog opens.
6. Select the data to be backed up.
7. Select a destination folder and a file name for the *.psb backup file.
8. Set "Transfer" mode on the HMI device.
9. Start the backup operation in WinCC flexible with "OK" on the configuration computer.
Follow the instructions in WinCC flexible.
A status view opens to indicate the progress of the operation.
Result
The system outputs a message when the backup is completed.
The relevant data is now backed up on the configuration computer.
Procedure - restore
Proceed as follows:
1. When restoring with reset to factory setting only:
Switch off power to the HMI device.
2. Select the menu command "Project ▶ Transfer ▶ Communication Settings" in WinCC
flexible on the configuration computer.
The "Communication Settings" dialog opens.
3. Select the HMI device type.
4. Set the connection parameters.
5. Close the dialog with "OK".
6. In WinCC flexible, select the menu command "Project ▶ Transfer ▶ Restore".
The "Restore Settings" dialog dialog opens.
7. Select the *.psb backup file to be restored from the "Open" dialog.
The view shows from which HMI device the backup file originates and the type of data it
contains.
8. To restore the password list:
Set "Transfer" mode on the HMI device.
9. Start the restore operation in WinCC flexible with "OK" on the configuration computer.
Follow the instructions in WinCC flexible.
A status view opens to indicate the progress of the operation.
Result
The transfer is completed when the backup data is restored from the configuration computer
to the HMI device.
Preparing and backing up a project
7.3 Backup and restore
OP 73micro, TP 177micro (WinCC flexible)
98 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
See also
Configure the data channel (Page 88)
Configure the data channel (Page 79)
Setting the operating mode (Page 90)
Overview of backup and restoring (Page 95)
Data Transfer Options (Page 92)
7.3.4 Backup and Restore via ProSave
Introduction
Backup and restore operations transfer the relevant data between flash memory on the HMI
device and a PC.
Requirement
● The HMI device is connected to a PC on which ProSave is installed.
● Only for restoring the password list or when backing up the data:
The data channel is configured on the HMI device.
Procedure - backup
Proceed as follows:
1. From the Windows Start menu, run ProSave on the PC.
2. Select the HMI device type from the "General" tab.
3. Set the connection parameters in the "General" tab.
4. Use the "Backup" tab to select the relevant data.
5. Select a destination folder and a file name for the *.psb backup file.
6. Set "Transfer" mode on the HMI device.
7. Start the backup operation in ProSave with "Start Backup".
Follow the instructions in ProSave.
A status view opens to indicate the progress of the operation.
Result
The system outputs a message when the backup is completed.
The relevant data is now backed up on the PC.
Preparing and backing up a project
7.3 Backup and restore
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 99
Procedure - restore
Proceed as follows:
1. When restoring with reset to factory setting only:
Switch off power to the HMI device.
2. From the Windows Start menu, run ProSave on the PC.
3. Select the HMI device type from the "General" tab.
4. Set the connection parameters in the "General" tab.
5. Select the *.psb backup file to be restored from the "Restore" tab.
The tool outputs a message showing the HMI device for which the backup copy was
created and the type of backup data contained in this file.
6. To restore the password list:
Set "Transfer" mode on the HMI device.
7. Start the restore operation in ProSave with "Start Restore".
Follow the instructions in ProSave.
A status view opens to indicate the progress of the operation.
Result
The transfer is completed when the backup data is restored from the PC to the HMI device.
See also
Configure the data channel (Page 88)
Configure the data channel (Page 79)
Setting the operating mode (Page 90)
Overview of backup and restoring (Page 95)
Data Transfer Options (Page 92)
Preparing and backing up a project
7.4 Updating the operating system
OP 73micro, TP 177micro (WinCC flexible)
100 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
7.4 Updating the operating system
7.4.1 Overview
Overview
A compatibility conflict may occur when transferring a project to the HMI device. This is
caused by different versions of the engineering software and the HMI device image. The
configuration computer cancels the transfer and triggers an alarm to indicate a compatibility
conflict. You must update the operating system of the HMI device.
NOTICE
Data loss
An operating system update deletes all data such as projects and passwords from the HMI
device.
Preparing and backing up a project
7.4 Updating the operating system
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 101
7.4.2 Updating the operating system using WinCC flexible
Requirements
● The HMI device is connected to a configuration computer.
● No project is open in WinCC flexible.
Procedure
Proceed as follows:
1. Switch off power to the HMI device.
2. Select the menu command "Project ▶ Transfer ▶ Communication Settings" in WinCC
flexible on the configuration computer.
This opens the "Communication Settings" dialog.
3. Select the HMI device type.
4. Set the connection parameters.
5. Close the dialog with "OK".
6. In WinCC flexible, select the menu command "Project ▶ Transfer ▶ Update operating
system".
7. In "Image path," select the folder which contains the HMI device image file, *.img.
The HMI device image files are available under "WinCC flexible Images" in the WinCC
flexible installation folder and on the corresponding WinCC flexible installation CD.
8. Select "Open".
In the output area, you are provided information on the version of the HMI device image
file after it is opened.
9. In WinCC flexible, select "Update OS" to run the operating system update.
Follow the instructions in WinCC flexible.
A status view opens to indicate progress.
Result
The system outputs and alarm when the operating system update is completed.
This operation has deleted the project data from the HMI device.
See also
Overview (Page 100)
Data Transfer Options (Page 92)
Preparing and backing up a project
7.4 Updating the operating system
OP 73micro, TP 177micro (WinCC flexible)
102 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
7.4.3 Updating the operating system in ProSave
Requirements
● The HMI device is connected to a PC on which ProSave is installed.
Procedure
Proceed as follows:
1. Switch off power to the HMI device.
2. From the Windows Start menu, run ProSave on the PC.
3. Select the HMI device type from the "General" tab.
4. Set the connection parameters.
5. Select the "OS Update" tab.
6. In "Image path," select the folder which contains the HMI device image file, *.img.
The HMI device image file is available on the corresponding WinCC flexible installation
CD.
7. Select "Open".
In the output area, you are provided information on the version of the HMI device image
file after it is opened.
8. On the PC, select "Update OS" to run the operating system update.
Follow the instructions in ProSave.
A status view opens to indicate progress.
Result
The system outputs and alarm when the operating system update is completed.
This operation has deleted the project data from the HMI device.
See also
Overview (Page 100)
Data Transfer Options (Page 92)
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 103
Operating a project 8
8.1 Operating a project on OP 73micro
8.1.1 Overview
Soft keys with global function assignment
A soft key with global function assignment always triggers the same action on the HMI
device or in the PLC, regardless of the current screen. An example of such an action is the
activation of a screen.
The soft key of a screen can be assigned either a global or a local function. The local
function takes priority over the global setting.
Soft keys with local function assignment
A soft key with local function assignment is screen-specific and is therefore only effective
within the active screen.
The function assigned to a soft key can vary from screen to screen.
Operation with key combinations
Unwanted actions may be triggered if the operator unintentionally actuates a key
combination.
CAUTION
Unintentional actions
In "Online" mode, simultaneous operation of more than two keys may cause unintentional
actions in the plant.
Never press more than two keys simultaneously.
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
104 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
System keys
The system keys (control keys) are used for operator input on the HMI device.
Table 8-1 Overview of control keys
Function Action
Moving the cursor
DEL
,
INS
Activates the next field in horizontal direction
TAB
,
+/–
Activates the next field in vertical direction
Activate field
SHIFT +
TAB
Activates the next field in the tab order defined in your project
SHIFT Enables an overlay function of a further system key
Viewing infotext
SHIFT + ESC
HELP
Opens a window containing infotext on the selected object
You can press
ENTER
to toggle between infotext for a screen and an object,
for example, for an IO field.
Cancel action.
ESC
HELP
• Undo
You can undo your input as long you have not yet confirmed it with
ENTER
.
• Close the alarm window - if configured.
• Cancel the output of infotext to return to the previous view.
Acknowledge alarm
ACK
Acknowledges the current indicated or selected alarm or all alarms of an
acknowledgment group, depending on your configuration.
ENTER
• Call editing mode – initiates input with
TAB
and
+/–
• Exit editor mode and confirm input
Navigating in lists
Table 8-2 Keys for navigation in lists
Button Action on pressing
TAB
or
+/–
Selects the previous or next list entry
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 105
8.1.2 Setting the project language
Introduction
The HMI device supports multilingual projects. You need to configure a corresponding
operator control object which lets you change the language setting on the HMI device during
runtime.
The project always starts with the language set in the previous session.
Requirements
● The relevant project language must be available on the HMI device.
● The language changeover function must be logically linked to a configured operator
control object such as a button.
Selecting a language
You can change project languages at any time. Language-specific objects are immediately
output to the screen in the relevant language when you switch languages.
The following options are available for switching the language:
1. A configured operator control object switches from one project language to the next in a
list.
2. A configured operator control directly sets the desired project language.
Further information on this may be available in your plant documentation.
8.1.3 Entries and help within a project
8.1.3.1 Overview
Procedure
Values are entered in the project input fields. The values are transferred from the input fields
to the PLC.
Proceed as follows:
1. Select the required input field on the screen.
Based on your configuration, you can enter the following type of values in the input field:
– Numerical
– Alphanumerical
– Symbolic
– Date/time
2. Set the value.
3. Confirm your entries with
ENTER
or cancel your entries with ESC
HELP
.
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
106 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Numerical values
Enter the characters of numerical values using the system keyboard. Press
ENTER
to edit any
character of the value with the help of the cursor keys.
You can delete a value from the field by pressing SHIFT +
DEL
.
Formats for the visualization of numerical values
You can enter values in numerical input fields based on the following formats:
● Decimal
● Hexadecimal
● Binary
The entry can be aligned left or right, depending on the configuration.
Limit value test of numerical values
Tags can be assigned limit values. If an alarm window has been configured, a system alarm
is automatically output to indicate any violation of set limits of the input value, for example,
80 exceeds the set limit value of 78. The value entered is rejected. The original value is
displayed again.
Decimal places for numerical values
If a numerical input field is configured for a specific number of decimal points, decimal places
in excess of the limit are ignored. Empty decimal places are filled with "0" after the number is
confirmed.
Alphanumerical values
Enter the alphanumerical values, numbers and letters character by character using the
system keyboard. Press
ENTER
to edit any character of the value with the help of the cursor
keys.
You can delete a value from the field by pressing SHIFT +
DEL
.
The extended character set is available for fields with "String" format.
Symbolic values
Symbolic values are by selecting configured entries and not using the keyboard. These
entries are stored in symbolic IO fields.
Date and time
Date and time are entered in alphanumerical format.
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 107
8.1.3.2 Entering and Editing Numerical and Alphanumerical Values
Requirement
An IO field has been enabled with SHIFT +
TAB
or using the cursor keys.
Navigating in fields
Table 8-3 Overview of control keys for navigating in fields
Key Action
DEL
or
INS
The previous or following character is marked.
Control keys for character input
Table 8-4 Overview of the control keys for character input
Key Action
SHIFT +
+/–
Changes the sign of a numerical value.
Press SHIFT +
+/–
to toggle between the two characters.
SHIFT This toggles between upper and lower case letters.
TAB
or
+/–
All characters available in the extended character set are called in
succession.
ENTER
Validates the input
ESC
HELP
Deletes the entry
Restores the original value
Options of entering numerical and alphanumerical characters:
● Enters value and thereby fully replace the existing value
● Edit a character in an existing value
Procedure – entering values
To enter a new value instead of editing a character, you can delete the entire contents of the
input field.
Proceed as follows:
1.
DEL
press to mark the entire field contents
2. Enter the value with
TAB
or
+/–
.
3. Press
ENTER
.
This confirms your entries. To cancel the entry, press ESC .
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
108 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Procedure – editing specific characters of a value
Proceed as follows:
1. Press
ENTER
.
2. Select the relevant character with
INS
or
DEL
.
3. Replace the character with
TAB
or
+/–
.
4. Press
ENTER
.
This confirms your entries. To cancel the entry, press ESC .
Call sequence of the characters
When you initially enter a value in an alphanumerical input field, the letter "A" is called by
pressing
ENTER
or
INS
. The same applies when you add characters.
The following applies for further entries:
● Press
TAB
to enter letters.
Upper and lower case letters are indicated first, followed by the special characters and
numbers.
To toggle between an upper and a lower case letter, press SHIFT .
● Press
+/–
to enter numbers.
The list opens with various special characters and continues with the numbers.
Press
+/–
or
TAB
to view the next value if you already entered a value.
Procedure – deleting a character
1. Press
ENTER
.
2. Position the cursor on the character to be deleted.
3. Press SHIFT +
DEL
.
The selected character will be deleted. The remaining characters to the right of the cursor
shift by one position to the left.
If the characters are right aligned:
The selected character will be deleted. The remaining characters to the left of the cursor
shift one position to the right.
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 109
Procedure – inserting characters
1. Press
ENTER
.
2. Move the cursor to the required position.
3. Press SHIFT +
INS
to insert a space character.
The characters already entered move one position to the right from the cursor position.
If the characters are right aligned:
The characters already entered move one position to the left from the cursor position.
Example for numerical input
Activate the the input box. The following table shows the keys you need to press to enter
"–12.34":
Key Instruction Display
ENTER
Press 1 x to begin input
DEL
Press 5 x to move the marking five positions to the left
+/–
Keep pressing until "-" appears
INS
Press 1 x to move the marking one position to the right
TAB
Keep pressing until "1" appears
INS
Press 1 x to move the marking one position to the right
TAB
Keep pressing until "2" appears
INS
Press 2 x to move the marking one position to the right
TAB
Keep pressing until "3" appears
INS
Press 1 x to move the marking one position to the right
TAB
Keep pressing until "4" appears
ENTER
Press 1 x to end input
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
110 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Example for alphanumerical input
Activate the the input box. The following table shows the keys you need to press to enter
"OP 73":
Key Instruction Display
ENTER
Press 1 x to begin input
$
TAB
Keep pressing until "O" appears
2
INS
Press 1 x to move the marking one position to the
right
2$
TAB
Keep pressing until "P" appears
23
SHIFT +
INS
Press both keys 1 x simultaneously to create a
space character
23
INS
Press 1 x to move the marking one position to the
right
23 $
+/–
Keep pressing until "7" appears
23
INS
Press 1 x to move the marking one position to the
right
23 $
+/–
Keep pressing until "3" appears
23
ENTER
Press 1 x to end input
32
8.1.3.3 Entering and editing symbolic values
Requirements
A symbolic IO field has been with SHIFT +
TAB
or using the cursor keys.
Control keys for character input
Button Action
TAB
,
+/–
Scrolls in a single-line list field until the required entry is found
ENTER
Validates the selected entry
Disables editing mode
ESC
HELP
Restores the original entry
Disables editing mode
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 111
Procedure
Proceed as follows:
1. Enable the selection list with
ENTER
.
This enables the selection list which contains the configured symbolic entries.
2. Select an entry with
TAB
or
+/–
.
3. Save or cancel the entry.
8.1.3.4 Entering and modifying date and time
Requirements
A date/time input field has been enabled with SHIFT +
TAB
or using the cursor keys.
Entering the date and time
Use numerical and alphanumerical values to set the date and time.
Note
When entering the date and time, please note that the format is determined by the
configured project language.
See also
Entering and Editing Numerical and Alphanumerical Values (Page 107)
Setting the project language (Page 105)
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
112 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
8.1.3.5 Viewing infotext
Introduction
The configuration engineer uses infotext to provide additional information and operating
instructions with respect to screens and operable screen objects.
An infotext may contain information on the value to be set in an IO field, for example.
Enter temperature
setpoint for Tank_1
(Range 40 to 80 °C)
Figure 8-1 Infotext for an IO field, example
A help indicator can also been configured.
Figure 8-2 Help indicator
If there is an infotext available for the active screen, the help indicator is always displayed. If
infotext is available for a screen object, the help indicator is displayed as soon as the cursor
is placed over the screen object. If there is no infotext for the selected operator control object
or the active screen, the help indicator is hidden.
Procedure
To view an infotext on the HMI device, press SHIFT + ESC
HELP
. There are two viewing options:
● If the cursor is positioned in a field for which infotext has been configured, press SHIFT +
ESC
HELP
to view the infotext.
● If SHIFT + ESC
HELP
is pressed and no infotext is available for the field, the infotext configured
for the active screen is shown instead.
If an infotext is not available for this active screen, the system opens the following dialog:
No info text available!
In this dialog, scroll through the list with
TAB
or
+/–
. Press ESC
HELP
to close the dialog.
If you have configured screen and IO field infotexts, you can toggle these in your view by
pressing
ENTER
.
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 113
8.1.4 Project security
Overview
Operation of a project can be protected by the configuration engineer by implementing a
security system.
If operator control objects protected by a password are operated, the HMI device requests
the entry of a password. A logon dialog opens for you to enter the password.
User: Admin
Password:
OK Cancel
Figure 8-3 Logon dialog
Enter the password in the "Password" input field of the logon dialog.
Proceed as follows:
1. Press
ENTER
.
2. Press and hold the
+/–
or
TAB
key until the required character appears.
3. To obtain additional characters, press
INS
and select the character with
+/–
or
TAB
.
4. When the password is completed, enable the "OK" button with SHIFT +
TAB
and press
ENTER
. Select "Cancel" to cancel the operation.
You can use the protected control objects after you completed the logon.
The Logon dialog can be set up by the configuration engineer via an individual operator
control object.
In the same way, the configuration engineer can set up an operator control object to log off.
After logging off, objects assigned password protection can no longer be operated; to do so,
log on again.
Further information on this may be available in your plant documentation.
Logoff time
A user logoff timeout can be set in the system. If the time between any two user actions, e.g,
entering a value or changing screens, exceeds this logoff time, the user is automatically
logged off. The user must then log on again to continue to operate objects assigned
password protection.
Operating a project
8.1 Operating a project on OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
114 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Password
The password and logoff timeout values are coded in a list and saved to non-volatile memory
on the HMI device.
Note
Depending on the transfer settings, changes to the password list are overwritten when the
project is transferred again.
Backup and restore
You can backup the password and restore it using ProSave or WinCC flexible.
NOTICE
On restoring, the currently valid password is overwritten. The restored password is
immediately valid.
8.1.5 Close the project.
Procedure
Proceed as follows:
1. Use the corresponding operator control object to close the project.
Wait for the Loader to open after you closed the project.
2. Switch off power to the HMI device.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 115
8.2 Operating a project on TP 177micro
8.2.1 Overview
Operating touch objects
Touch objects represent touch-sensitive operator control objects on the HMI device screen
such as buttons, IO fields and alarm windows. Touch objects are basically operated in the
same way as conventional keys. You operate touch objects by touching them with your
finger.
The project may contain operations which require in-depth, device-specific information from
the operator and must be executed with particular care, for example, simulation of jog mode.
Further information on this may be available in your plant documentation.
CAUTION
Never touch more than one object on the screen. Never touch more than one touch object
at a time, otherwise you may trigger unintentional actions.
CAUTION
Do not use any pointed or sharp objects when operating the touch screen in order to avoid
damage to its plastic screen membrane.
Operation feedback
The HMI device provides optical feedback when it detects the operation of a touch object.
This feedback is independent of any communication with the PLC. Therefore, this feedback
does not indicate whether the relevant action is actually executed or not.
The configuration engineer may also have configured the feedback function in a different
manner. Further information on this may be available in your plant documentation.
Optical feedback
The type of optical feedback depends on the operator control object:
● Buttons
The HMI device outputs different views of the "Touched" and "Untouched" states,
provided the configuration engineer has configured a 3D effect:
– "Touched" state:
– "Untouched" state:
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
116 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
The configuration engineer defines the appearance of a selected field, for example, its
line width and color for the focus.
● Invisible buttons
The focus for invisible buttons is not identified after selection by default.
The configuration engineer may, however, configure invisible buttons so that their outline
appears when touched. This outline remains visible until the you select another operator
control object.
● IO fields
After you touch an IO field, a screen keyboard appears as feedback.
8.2.2 Setting the project language
Introduction
The HMI device supports multilingual projects. You need to configure a corresponding
operator control object which lets you change the language setting on the HMI device during
runtime.
The project always starts with the language set in the previous session.
Requirements
● The relevant project language must be available on the HMI device.
● The language changeover function must be logically linked to a configured operator
control object such as a button.
Selecting a language
You can change project languages at any time. Language-specific objects are immediately
output to the screen in the relevant language when you switch languages.
The following options are available for switching the language:
1. A configured operator control object switches from one project language to the next in a
list.
2. A configured operator control directly sets the desired project language.
Further information on this may be available in your plant documentation.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 117
8.2.3 Entries and help within a project
8.2.3.1 Overview
Procedure
Values are entered in the project input fields. The values are transferred from the input fields
to the PLC.
Proceed as follows:
1. Touch the input field required on the screen.
The screen keyboard opens.
Based on your configuration, you can enter the following type of values in the input field:
– Numerical
– Alphanumerical
– Symbolic
– Date/time
2. Set the value.
3. Confirm the entry.
Screen keyboard
When you touch an input object such as an IO field on the HMI device touch screen, a
screen keyboard appears. This screen keyboard is also shown when it is necessary to enter
a password to access protected functions. The keyboard is automatically hidden again when
input is complete.
Based on the configuration of the input object, the system opens a screen keyboard for
entering numerical, alphanumerical or symbolic values.
Note
The screen keyboard display is independent of the configured project language.
Numerical values
You can enter numerical values character by character using the numerical screen
keyboard.
Format patterns of numerical values
You can enter values in numerical input fields based on the following formats:
● Decimal
● Hexadecimal
● Binary
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
118 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Limit value test of numerical values
Tags can be assigned limit values. The current limit values are indicated in the numerical
screen keyboard. If an alarm window has been configured, a system alarm is automatically
output to indicate any violation of the configured input value limits. For example, 80 exceeds
the configured limit value of 78. The entered value is therefore rejected and the original value
is displayed again.
Decimal places for numerical values
If a numerical input field is configured for a specific number of decimal points, decimal places
in excess of the limit are ignored. Empty decimal places are filled with "0" after the number is
confirmed.
Alphanumerical values
Alphanumerical values (numbers and letters) can be entered character by character using
the alphanumerical screen keyboard.
Symbolic values
Symbolic values are entered from a list of predefined entries using the symbolic screen
keyboard.
Date and time
You can enter date/time values character by character using the alphanumerical screen
keyboard.
8.2.3.2 Entering and editing numerical values
Numerical screen keyboard
When you touch an IO field on the HMI device touch screen, the numerical screen keyboard
appears. The keyboard is automatically hidden again when input is complete.
Figure 8-4 Numerical screen keyboard
The layout of the screen keyboard for a vertically mounted HMI device differs slightly from
that shown in the figure above.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 119
Procedure
You can enter numerical and hexadecimal values character by character using the numerical
screen keyboard
Proceed as follows:
1. Touch the relevant IO field on the screen.
The numerical screen keyboard opens and displays the current value.
2. Set the value.
You can only operate keys which are visualized in 3D format. The type of value to be
entered determines whether a key is enabled or disabled.
The following options for entering values are available:
– The current value is deleted when you enter the first character. Enter the value again.
– Use the and keys to move the cursor within the current value. You can
now edit the characters of the current value or add characters.
Use the key to delete the character to the left of the cursor.
– Use the key to change the sign of the value.
– Select to view the infotext of the IO field.
This button is only enabled if infotext has been configured for the IO fields.
3. Select to confirm your entries or cancel them with . Both actions close the
screen keyboard.
Note
Numerical IO fields can be assigned limit values. In this case, values are only accepted if
they lie within configured limits. If you enter a value that is outside the configured limits,
the system rejects this value and restores the original. The HMI device outputs a system
alarm to indicate this situation.
When the screen keyboard appears, the high and low limit values are indicated if
configured.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
120 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
8.2.3.3 Entering and editing alphanumerical values
Alphanumerical screen keyboard
When you touch an IO field on the HMI device touch screen, the alphanumerical screen
keyboard appears. The keyboard is automatically hidden again when input is complete.
Figure 8-5 Alphanumerical screen keyboard, standard layer
The layout of the screen keyboard for a vertically mounted HMI device differs slightly from
that shown in the figure above.
Keyboard layers
The alphanumerical keyboard is organized in several layers:
● Standard layer
● Shift layer
Procedure
You can enter numerical values character by character using the alphanumerical screen
keyboard.
Proceed as follows:
1. Touch the relevant IO field on the screen.
The alphanumerical screen keyboard opens and displays the current value.
2. Set the value.
The following options for entering values are available:
– The current value is deleted when you enter the first character. Enter the value again.
– Use the and keys to move the cursor within the current value. You can
now edit the characters of the current value or add characters.
Use the key to delete the character to the left of the cursor.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 121
– Use the key to toggle between the Shift layer and standard layer of the
keyboard. When you toggle the layer, the key labels on the screen keyboard change.
– Select to view the infotext of the IO field.
This button is only enabled if infotext has been configured for the IO fields.
3. Select to confirm your entries or cancel them with . Both actions close the
screen keyboard.
8.2.3.4 Entering and editing symbolic values
Symbolic screen keyboard
When you touch a symbolic IO field on the HMI device touch screen, the symbolic screen
keyboard appears. The keyboard is automatically hidden again when input is complete.
Figure 8-6 Symbolic screen keyboard
The layout of the screen keyboard for a vertically mounted HMI device differs slightly from
that shown in the figure above.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
122 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Procedure
Set symbolic values with the help of the symbolic screen keyboard.
Proceed as follows:
1. Touch the relevant IO field on the screen.
The symbolic screen keyboard opens and displays the current value.
2. Select an entry from the selection list.
The following options for selecting the entry are available:
– Position the cursor directly on the entry in the selection list by touching the entry.
– Move the cursor to an entry in the selection list using the , , or
keys.
– Select to view the infotext of the symbolic IO field.
This button is only enabled if infotext has been configured for the symbolic IO field.
3. Select to confirm your entries or cancel them with . Both actions close the
screen keyboard.
8.2.3.5 Entering and modifying date and time
Entering the date and time
Enter the date and time in the same way you enter alphanumerical values.
Note
When entering the date and time, please note that the format is determined by the
configured project language.
See also
Entering and editing alphanumerical values (Page 120)
Setting the project language (Page 116)
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 123
8.2.3.6 Viewing infotext
Purpose
The configuration engineer uses infotext to provide additional information and operating
instructions with respect to screens and operable screen objects.
Infotext can provide information on the value to be entered in an IO field, for example.
Figure 8-7 Infotext for an IO field, example
Infotext for input objects
Touch the key on the screen keyboard. This key is only enabled if infotext has been
configured for the input object.
Infotext for the current screen
The configuration engineer can also provide infotext for screens. However, the infotext for
the current screen is called up by an operator control object assigned to this function and not
by the screen keyboard.
Further information on this may be available in your plant documentation.
Closing the infotext
Close the infotext with .
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
124 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
8.2.4 Project security
Overview
Operation of a project can be protected by the configuration engineer by implementing a
security system.
If operator control objects protected by a password are operated, the HMI device requests
the entry of a password. A logon dialog opens for you to enter the password.
Figure 8-8 Logon dialog
You can use the protected control objects after you completed the logon.
The Logon dialog can be set up by the configuration engineer via an individual operator
control object.
In the same way, the configuration engineer can set up an operator control object to log off.
After logging off, objects assigned password protection can no longer be operated; to do so,
log on again.
Further information on this may be available in your plant documentation.
Logoff time
A user logoff timeout can be set in the system. If the time between any two user actions, e.g,
entering a value or changing screens, exceeds this logoff time, the user is automatically
logged off. The user must then log on again to continue to operate objects assigned
password protection.
Password
The password and logoff timeout values are coded in a list and saved to non-volatile memory
on the HMI device.
Note
Depending on the transfer settings, changes to the password list are overwritten when the
project is transferred again.
Backup and restore
You can backup the password and restore it using ProSave or WinCC flexible.
NOTICE
On restoring, the currently valid password is overwritten. The restored password is
immediately valid.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 125
8.2.5 Close the project.
Procedure
Proceed as follows:
1. Use the corresponding operator control object to close the project.
Wait for the Loader to open after you closed the project.
2. Switch off power to the HMI device.
8.2.6 Operating the Trend View
8.2.6.1 Overview
Trends
Trends continuously display the current process data.
Trend View
Trends are displayed in the Trend view. A Trend view can display up to four trends
simultaneously. The figure below shows an example of a Trend view:
① Ruler
② Trend value in the value table
The appearance, axes, value range and labels of the Trend view can be set by the
configuration engineer.
The configuration engineer can set limits for the trend values. A color transition can be
configured when the limits are exceeded.
Further information on this may be available in your plant documentation.
Operating a project
8.2 Operating a project on TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
126 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Value Table
The trend values can be read from the value table, if this is configured.
Ruler
The exact trend values can be read from the ruler, if this is configured.
8.2.6.2 Operating the Trend View
Value Table
The trend values are displayed in the value table. When the ruler is displayed, the trend
values are shown at a position of the ruler. When the ruler is hidden, the latest trend values
are displayed.
Ruler
When configured, a ruler is available to provide an exact reading of the individual values.
The position of the ruler can be changed by touching and dragging it on the touch screen.
The configuration engineer can configure the following actions for operator controls outside
the Trend display:
● Display or hide ruler
● Move ruler forward
● Move ruler backward
Further information on this may be available in your plant documentation.
Other Operator Actions
The configuration engineer can configure the following actions for operator controls outside
the Trend display:
● Enlarge display of time intervals
● Reduce display of time intervals
● Scroll back by one display width
● Scroll forward by one display width
● Stop or resume trend recording
Further information on this may be available in your plant documentation.
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 127
Operating alarms 9
9.1 Overview
Alarms
Alarms indicate events and states on the HMI device which have occurred in the system, in
the process or on the HMI device itself. A status is reported when it is received.
An alarm could trigger one of the following alarm events:
● Activate
● Deactivate
● Acknowledge
The configuration engineer defines which alarms must be acknowledged by the user.
An alarm may contain the following information:
● Date
● Time
● Alarm text
● Location of fault
● Status
● Alarm class
● Alarm number
● Acknowledgement group
Operating alarms
9.2 Operating alarms on the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
128 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Alarm classes
Alarms are assigned to various alarm classes:
● Error
Alarms in this class must always be acknowledged. Alarms normally indicate critical
errors within the plant such as "Motor temperature too high".
● Warning
Warning alarms usually indicate states of a plant such as "Motor switched on".
● System
System alarms indicate states or events which occur on the HMI device.
● User-specific alarm classes
The properties of this alarm class must be defined in the configuration.
Further information on this may be available in your plant documentation.
Alarm buffer
Alarm events are saved to an internal, volatile buffer. The size of this alarm buffer depends
on the HMI device type.
9.2 Operating alarms on the OP 73micro
9.2.1 Displaying alarms
Alarm view and alarm window
Alarms are indicated in the alarm view or in the alarm window on the HMI device.
156 12:05:49 Alarm
Engine 23 too hot
Figure 9-1 Alarm view
12584
34541
45238
156 12:05:49 Alarm
Engine 23 too hot
Figure 9-2 Alarm window
The layout and operation of the alarm window correspond to that of the alarm view.
The alarm window is independent of the process screen. Depending on the configuration,
the alarm window appears automatically as soon as a new, unacknowledged alarm has been
received. The alarm window can be configured so that it only closes after all the alarms have
been acknowledged.
Additional information on this may be available in your plant documentation.
Operating alarms
9.2 Operating alarms on the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 129
Operator control components
Functions of the HMI device keys in the alarm view:
Button Function
SHIFT + ESC
HELP
Show an alarm infotext
ENTER
Edit alarm
ACK Acknowledge alarm
INS
Show the full text of the selected alarm in a separate window, the alarm text
window. You can scroll the alarm text window using the cursor keys.
TAB
,
+/–
Select the next or previous alarm from the alarm view
Alarm class layout
The various alarm classes are identified in order to distinguish between them in the alarm
view.
Symbol Alarm class
! Error
(empty) Warning
(depending on the
configuration)
User-defined alarm classes
$ System
The configuration engineer can edit the alarm class symbols. Additional information on this
may be available in your plant documentation.
Displaying infotext
An alarm can be assigned an infotext.
Proceed as follows to view the infotext:
1. Select the relevant alarm in the alarm view using the cursor keys.
2. Press SHIFT and ESC
HELP
.
The infotext assigned to this alarm is shown.
3. Press ESC
HELP
to close the infotext.
Operating alarms
9.2 Operating alarms on the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
130 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Viewing long alarm text
The alarm text window can be used to view infotexts which can not be output in full length in
the alarm view.
1. Select the alarm using the cursor keys.
2. Press
INS
.
This opens the alarm text window shown below.
502 15:05:49 Alarm
switch off unit 4,
close by- pass stop valve 2,
open pipes 12 and 53,
disconnect main linkage,
start cooling unit 23 and
acknowledge buttom ACK
3. Press
+/–
or
TAB
to view the full alarm text.
4. Press ESC
HELP
.
This closes the alarm text window.
Alarm indicator
The alarm indicator is a graphic symbol that shows alarms to be acknowledged.
The following figure shows the alarm indicator:
The alarm indicator flashes as long as alarms are queued for acknowledgment. The alarm
indicator is displayed and does not flash as long as acknowledged alarms are still queued.
When no alarm is in the queue, the alarm indicator is hidden.
Operating alarms
9.2 Operating alarms on the OP 73micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 131
9.2.2 Acknowledging an Alarm
Requirements
● The alarm to be acknowledged is shown in the alarm window or in the alarm view.
● Either the alarm window or the alarm view is enabled.
● The alarm must be acknowledged.
Procedure
Proceed as follows to acknowledge an alarm:
1. From the alarm window or alarm view, select the relevant alarm using the cursor keys.
2. Press ACK .
Result
The alarm or all alarms of the corresponding acknowledgement group are acknowledged.
You may find additional information about acknowledgment groups in your plant
documentation.
See also
Displaying alarms (Page 128)
9.2.3 Editing an Alarm
Introduction
The configuration engineer can assign additional functions to each alarm. These functions
are executed when the alarm is processed.
Requirements
● The alarm to be edited is indicated in the alarm window or in the alarm view.
● Either the alarm window or the alarm view is enabled.
Procedure
Proceed as follows to edit an alarm:
1. From the alarm view, select the alarm you want to edit using the cursor keys.
2. Press
ENTER
.
Operating alarms
9.3 Operating alarms on the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
132 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Result
The system executes the additional functions of the alarm. You may find additional
information on this in your plant documentation.
Note
When you edit an unacknowledged alarm, it is acknowledged automatically.
See also
Displaying alarms (Page 128)
9.3 Operating alarms on the TP 177micro
9.3.1 Displaying alarms
Alarm view and alarm window
Alarms are indicated in the alarm view or in the alarm window on the HMI device.
The layout and operation of the alarm window correspond to that of the alarm view.
The alarm window is independent of the process screen. Depending on the configuration,
the alarm window appears automatically as soon as a new, unacknowledged alarm has been
received. The alarm window can be configured so that it only closes after all the alarms have
been acknowledged.
Further information on this may be available in your plant documentation.
Operating alarms
9.3 Operating alarms on the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 133
Operator control components
Functions of the alarm view buttons:
Button Function
Displays an alarm infotext
Edits an alarm
Acknowledges an alarm
Displays the full text of the selected alarm in a separate window, the alarm text
window If necessary, you can scroll in the alarm text window.
In the alarm text window, you can view alarm text that requires more space than is
available in the alarm view. Close the alarm text window with .
Selects the next or previous alarm from the list.
Scrolls one page up or down
Alarm class representation
The various alarm classes are identified in order to distinguish between them in the alarm
view.
Symbol Alarm class
! Error
(empty) Warning
(depends on the configuration) User-defined alarm classes
$ System
The configuration engineer can edit the alarm class symbols. Further information on this may
be available in your plant documentation.
Viewing infotext
The configuration engineer can also supply infotext for alarms.
To view an alarm infotext:
1. Select the required alarm in the alarm view.
2. Touch .
The infotext assigned to this alarm is shown.
3. Close the infotext window with .
Operating alarms
9.3 Operating alarms on the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
134 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Alarm indicator
The alarm indicator is a graphical symbol that shows current errors or errors which need to
be acknowledged, depending on the configuration.
Figure 9-3 Alarm indicator with three queued alarms
The alarm indicator flashes as long as alarms are queued for acknowledgment. The number
indicates the number of queued alarms. The configuration engineer can assign functions to
be executed when the alarm indicator is touched.
Usually, the alarm indicator is only used for error alarms. Further information on this may be
available in your plant documentation.
9.3.2 Acknowledging an Alarm
Requirements
● The alarm to be acknowledged is shown in the alarm window or in the alarm view.
● Either the alarm window or the alarm view is enabled.
● The alarm must be acknowledged.
Procedure
Proceed as follows to acknowledge an alarm:
1. Select the alarm by touching it in the alarm view or alarm window.
2. Touch .
Result
The alarm or all alarms of the corresponding acknowledgement group are acknowledged.
You may find additional information about acknowledgment groups in your plant
documentation.
See also
Displaying alarms (Page 132)
Operating alarms
9.3 Operating alarms on the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 135
9.3.3 Editing an Alarm
Introduction
The configuration engineer can assign additional functions to each alarm. These functions
are executed when the alarm is processed.
Requirements
● The alarm to be edited is indicated in the alarm window or in the alarm view.
● Either the alarm window or the alarm view is enabled.
Procedure
Proceed as follows to edit an alarm:
1. Select the alarm by touching it in the alarm view or alarm window.
2. Touch .
Result
The system executes the additional functions of the alarm. Further information on this may
be available in your plant documentation.
Note
When you edit an unacknowledged alarm, it is acknowledged automatically.
See also
Displaying alarms (Page 132)
Operating alarms
9.3 Operating alarms on the TP 177micro
OP 73micro, TP 177micro (WinCC flexible)
136 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 137
Maintenance and servicing 10
10.1 Maintenance and service
Scope of maintenance
The HMI device is designed for maintenance-free operation. Despite this, the touch screen
or keyboard membrane and the display must be cleaned regularly.
Preparation
CAUTION
Faulty operation
Always switch off the HMI device before cleaning it. This will ensure that you do not trigger
unintended functions when you touch the keys.
Use a cloth dampened with a cleaning agent to clean the equipment. Only use water with a
little liquid soap or a screen cleaning foam.
Procedure
Never spray the cleaning agent directly onto the HMI device. Apply it to a cloth. Never use
aggressive solvents or scouring powder.
CAUTION
Do not clean the HMI device with compressed air or steam jet blowers.
Maintenance and servicing
10.1 Maintenance and service
OP 73micro, TP 177micro (WinCC flexible)
138 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
10.1.1 Cleaning screen
Cleaning screen
Only applies to HMI devices with touch screen.
The HMI device touch screen can be cleaned when it is switched on and a project is running.
The configuration engineer must configure an operator control object for calling the Cleaning
Screen. Once the Cleaning Screen is activated, touch screen operation is locked for a
configurable period of time. The configuration engineer can lock the touch screen for a
duration between 5 and 30 seconds. The time remaining for the lock out is indicated by a
progress bar.
WARNING
Locking operator control objects
Always open the Cleaning Screen or switch off the HMI device, before you clean the touch
screen while the system is running!
Pay attention to the end of the operating lock by the Cleaning Screen function. Ignoring this
instruction may lead to inadvertent wrong operation.
10.1.2 Protective membrane
Protective membrane
A protective membrane is available for the HMI device touch screens. The relevant ordering
information is provided in the Siemens Catalog ST 80. The protective membrane is not
included in the HMI device package.
The self-adhesive membrane prevents the screen from being scratched and soiled. The mat
surface of the membrane reduces reflections under unfavorable lighting conditions.
The protective membrane can be removed without leaving any adhesive residue on the
screen.
CAUTION
Removing the protective membrane
Never use sharp or pointed tools, such as a knife, to remove the protective membrane. This
may damage the touch screen.
Maintenance and servicing
10.2 Servicing and spare parts
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 139
10.2 Servicing and spare parts
Repairs
A defective device must be returned to the manufacturer's site for repair. The HMI device
may only be repaired at the manufacturer's site.
Service pack
A service pack can be ordered for servicing purposes. It contains the following spare parts:
● Mounting seal
● Mounting clamps
● Terminal block (twin block)
The service pack can be ordered from your Siemens representative.
Maintenance and servicing
10.2 Servicing and spare parts
OP 73micro, TP 177micro (WinCC flexible)
140 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 141
Specifications 11
11.1 Dimensional drawings
11.1.1 Dimensional drawings, OP 73micro
6.2
137
67
28153
83
Figure 11-1 Overall dimensions of the HMI device
Specifications
11.1 Dimensional drawings
OP 73micro, TP 177micro (WinCC flexible)
142 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
11.1.2 Dimensional drawings, TP 177micro
212
6.2
140
156
196
44
Figure 11-2 Overall dimensions of the HMI device
Specifications
11.2 Specifications
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 143
11.2 Specifications
11.2.1 Specifications of the OP 73micro
Housing
Weight without packing Approx. 250 g
Display
Type LCD STN
Display area, active 79.98 mm x 23.98 mm (3")
Resolution 160 x 48 pixels
Colors, displayable 2
Contrast control yes
Back-lighting
Half Brightness Life, typical
LED green
100 000 h
Input unit
Type Membrane keyboard
System keys with dedicated functions 8
Soft keys
Of those freely configurable
4
4
Memory
Working memory 128 KB
Power supply
Nominal voltage
Range, permissible
+24 V DC
20.4 V to 28.8 V (–15%, +20%)
Transients, maximum permissible 35 V (500 msec)
Time between two transients, minimum 50 s
Current consumption at nominal power
• Typical
• Constant current, maximum
• Power on current surge I2t
• Approx. 80 mA
• Approx. 210 mA
• Approx. 0.5 A2s
Fuse, internal Electronic
Specifications
11.2 Specifications
OP 73micro, TP 177micro (WinCC flexible)
144 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
See also
Standards, Certificates and Approvals (Page 18)
Electromagnetic compatibility (Page 23)
Transport and storage conditions (Page 25)
Mounting information (Page 27)
Mounting positions and fixation (Page 30)
Information on insulation tests, protection class and degree of protection (Page 37)
11.2.2 Specifications of the TP 177micro
Enclosure
Weight without packing Approx. 750 g
Display
Type LCD-STN, blue mode
Display area, active 115.18 mm x 86.38 mm (5.7")
Resolution 320 x 240 pixels,
240 x 320 in vertical mounting position
Colors, displayable 4 grades of blue
Contrast control Yes
Back-lighting
Half Brightness Life, typical
CCFL
50,000 h
Input unit
Type Touch screen, resistive
Memory
Working memory 256 KB
Specifications
11.2 Specifications
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 145
Power supply
Nominal voltage
Range, permissible
+24 V DC
20.4 V to 28.8 V (–15%, +20%)
Transients, maximum permissible 35 V (500 msec)
Time between two transients, minimum 50 s
Current consumption at nominal power
• Typical
• Constant current, maximum
• Power on current surge I2t
• Approx. 240 mA
• Approx. 300 mA
• Approx. 0.5 A2s
Fuse, internal Electronic
See also
Standards, Certificates and Approvals (Page 18)
Electromagnetic compatibility (Page 23)
Transport and storage conditions (Page 25)
Mounting information (Page 27)
Mounting positions and fixation (Page 33)
Information on insulation tests, protection class and degree of protection (Page 37)
Specifications
11.3 Description of interfaces
OP 73micro, TP 177micro (WinCC flexible)
146 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
11.3 Description of interfaces
11.3.1 Power supply
Plug connector, 2-pin
21
Figure 11-3 Power supply pin assignment
PIN Assignment
1 +24 V DC
2 GND 24 V
11.3.2 RS485 (IF 1B) on OP 73micro
Sub-d socket, 9-pin, with screw lock
15
96
Figure 11-4 RS485 interface pin-out
PIN Assignment
1 n. c.
2 GND 24 V
3 Data channel B (+)
4 RTS
5 GND 5 V
6 +5 V DC
7 24 V DC, out (max. 100 mA) or 24 V DC in1
8 Data channel A (–)
9 n. c.
1 Applies when power is supplied from the CPU
CAUTION
Power supply
When the HMI device is supplied with power from the CPU, do not connect an external
power supply to it.
Specifications
11.3 Description of interfaces
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 147
11.3.3 RS 485 (IF 1B) on TP 177micro
Sub-d socket, 9-pin, with screw lock
15
96
Figure 11-5 RS 485 interface pin assignment
PIN Assignment
1 n. c.
2 GND 24 V
3 Data channel B (+)
4 RTS
5 GND 5 V
6 +5 V DC
7 +24 V DC, out (max. 100 mA)
8 Data channel A (–)
9 n. c.
Specifications
11.3 Description of interfaces
OP 73micro, TP 177micro (WinCC flexible)
148 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 149
Appendix A
A.1 ESD Directives
What does ESD mean?
All electronic modules are equipped with highly integrated modules or components. Based
on their design, these electronic components are highly sensitive to overvoltage and thus to
discharge of static electricity. These electronic components are therefore specially identified
as ESD.
Abbreviation
The following abbreviations are commonly used for electrostatic sensitive devices:
● ESD – Electrostatic Sensitive Devices
● ESD – Electrostatic Sensitive Device as common international designation
Labeling
ESD modules are labeled with the following symbol:
Figure A-1 ESD label
Appendix
A.1 ESD Directives
OP 73micro, TP 177micro (WinCC flexible)
150 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Electrostatic charge
CAUTION
Electrostatic charge
ESDs may be destroyed by voltages well below the perception threshold of persons
Voltages of this kind develop when a component or an assembly is touched by a person
who is not grounded against static electricity. Usually, it is unlikely that damage to an ESD
as a result of overvoltage is detected immediately but may become apparent only after a
longer period of operation.
Prevent electrostatic charge of your body before you touch the ESD!
Anyone who is not connected to the electrical potential of their surroundings is subjected to
electrostatic charge.
The figure indicates the maximum electrostatic charge anyone is subjected to when
contacting the materials shown. These values correspond with specifications to IEC 801-2.
9ROWDJH
5HODWLYHKXPLGLW\
>9@
>@
Figure A-2 Electrostatic voltages with which a person can be charged.
① Synthetic materials
② Wool
③ Antistatic materials such as wood or concrete
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 151
Protective measures against discharge of static electricity
CAUTION
Grounding measures
When working with electrostatic sensitive devices, make sure that the person, the
workplace and the packaging are properly grounded. This helps to avoid electrostatic
charge.
As a rule, only touch the ESD if this is unavoidable. Example: for maintenance. When you
touch modules, make sure that you do not touch the pins on the modules or the PCB tracks.
This prevents any discharge of static electricity to sensitive component and thus avoids
damage.
Discharge electrostatic electricity from your body if you are performing measurements on an
ESD. To do so, touch a grounded metallic object.
Always use grounded measuring instruments.
A.2 System alarms
Introduction
System alarms on the HMI device provide information about internal states of the HMI device
and PLC.
The overview below shows the causes of system alarms and how to eliminate the cause of
error.
Depending on functionality, only parts of the system alarms described in this section apply to
the various HMI devices.
Note
System alarms are only indicated if an alarm window was configured. System alarms are
output in the language currently set on your HMI device.
System alarm parameters
System alarms may contain encrypted parameters which are relevant to troubleshooting
because they provide a reference to the source code of the Runtime software. These
parameters are output after the text "Error code:"
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
152 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Meaning of the system alarms
Number Effect/cause Remedy
10000 The print job could not be started or was canceled
due to an unknown error. Faulty printer setup. Or:
Access to the network printer is not allowed.
Power supply failure during data transfer.
Check the printer settings, cable connections and the
power supply.
Set up the printer once again. Obtain a network printer
authorization.
If the error persists, contact the Hotline!
10001 No printer is installed or a default printer has not
been set up.
Install a printer and/or select it as the default printer.
10002 Overflow of the graphics buffer for printing. Up to
two images are buffered.
Allow sufficient intervals between successive print jobs.
10003 Images can now be buffered again. -
10004 Overflow of the buffer for printing lines in text mode
(e.g.alarms). Up to 1000 lines are buffered.
Allow sufficient intervals between successive print jobs.
10005 Text lines can now be buffered again. -
10006 The Windows printing system reports an error.
Refer to the output text and the error ID to
determine the possible causes. Nothing is printed
or the print is faulty.
Repeat the action if necessary.
20010 An error has occurred in the specified script line.
Execution of the script was therefore aborted. Note
the system alarm that may have occurred prior to
this.
Select the specified script line in the configuration.
Ensure that the tags used are of the allowed types.
Check system functions for the correct number and types
of parameters.
20011 An error has occurred in a script that was called by
the specified script.
Execution of the script was therefore aborted in the
called script.
Take the system alarm that may have occurred
prior to this into account.
In the configuration, select the script that has been called
directly or indirectly by the specified script.
Ensure that the tags used are of the allowed types.
Check the system functions for the correct number and
type of parameters.
20012 The configuration data is inconsistent. The script
could therefore not be generated.
Recompile the configuration.
20013 The scripting component of WinCC flexible Runtime
is not correctly installed. Therefore, no scripts can
be executed.
Reinstall WinCC flexible Runtime.
20014 The system function returns a value that is not
written in any return tag.
Select the specified script in the configuration.
Check if the script name has been assigned a value.
20015 Too many successive scripts have been triggered
in short intervals. When more than 20 scripts are
queued for processing, any subsequent scripts are
rejected. In this case, the script indicated in the
alarm is not executed.
Find what is triggering the scripts. Extend the times, e.g.
the polling time of the tags which trigger the scripts.
30010 The tag could not accept the function result, e.g.
when it has exceeded the value range.
Check the tag type of the system function parameter.
30011 A system function could not be executed because
the function was assigned an invalid value or type
in the parameter.
Check the parameter value and tag type of the invalid
parameter. If a tag is used as a parameter, check its
value.
40010 The system function could not be executed since
the parameters could not be converted to a
common tag type.
Check the parameter types in the configuration.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 153
Number Effect/cause Remedy
40011 The system function could not be executed since
the parameters could not be converted to a
common tag type.
Check the parameter types in the configuration.
50000 The HMI device is receiving data faster than it is
capable of processing. Therefore, no further data is
accepted until all current data have been
processed. Data exchange then resumes.
-
50001 Data exchange has been resumed. -
60000 This alarm is generated by the
“DisplaySystemAlarms” function. The text to be
displayed is transferred to the function as a
parameter.
-
60010 The file could not be copied in the direction defined
because one of the two files is currently open or the
source/target path is not available.
It is possible that the Windows user has no access
rights to one of the two files.
Restart the system function or check the paths of the
source/target files. Using Windows NT/2000/XP: The user
executing WinCC flexible Runtime must be granted
access rights for the files.
60011 An attempt was made to copy a file to itself.
It is possible that the Windows user has no access
rights to one of the two files.
Check the path of the source/target file.
Using Windows NT/2000/XP with NTFS: The user
executing WinCC flexible Runtime must be granted
access rights for the files.
70010 The application could not be started because it
could not be found in the path specified or there is
insufficient memory space.
Check if the application exists in the specified path or
close other applications.
70011 The system time could not be modified.
The error alarm only appears in connection with
area pointer "Date/time PC". Possible causes:
• An invalid time was transferred in the job
mailbox.
• The Windows user has no right to modify the
system time.
If the first parameter in the system alarm is
displayed with the value 13, the second parameter
indicates the byte containing the incorrect value.
Check the time which is to be set.
Using Windows NT/2000/XP: The user executing WinCC
flexible Runtime must be granted the right to change the
system time of the operating system.
70012 An error occurred when executing the function
"StopRuntime" with the option "Runtime and
operating system".
Windows and WinCC flexible Runtime are not
closed.
One possible cause is that other programs cannot
be closed.
Close all programs currently running.
Then close Windows.
70013 The system time could not be modified because an
invalid value was entered. Incorrect separators may
have been used.
Check the time which is to be set.
70014 The system time could not be modified. Possible
causes:
• An invalid time was transferred.
• The Windows user has no right to modify the
system time.
• Windows rejects the setting request.
Check the time which is to be set.
Using Windows NT/2000/XP: The user executing WinCC
flexible Runtime must be granted the right to change the
system time of the operating system.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
154 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
70015 The system time could not be read because
Windows rejects the reading function.
-
70016 An attempt was made to select a screen by means
of a system function or job. This is not possible
because the screen number specified does not
exist.
Or: A screen could not be generated due to
insufficient system memory.
Check the screen number in the function or job with the
screen numbers configured.
Assign the number to a screen if necessary.
70017 Date/Time is not read from the area pointer
because the address set in the controller is either
not available or has not been set up.
Change the address or set up the address in the
controller.
70018 Acknowledgment that the password list has been
successfully imported.
-
70019 Acknowledgment that the password list has been
successfully exported.
-
70020 Acknowledgment for activation of alarm reporting. -
70021 Acknowledgment for deactivation of alarm
reporting.
-
70022 Acknowledgment to starting the Import Password
List action.
-
70023 Acknowledgment to starting the Export Password
List action.
-
70024 The value range of the tag has been exceeded in
the system function.
The calculation of the system function is not
performed.
Check the desired calculation and correct it if necessary.
70025 The value range of the tag has been exceeded in
the system function.
The calculation of the system function is not
performed.
Check the desired calculation and correct it if necessary.
70026 No other screens are stored in the internal screen
memory.
No other screens can be selected.
-
70027 The backup of the RAM file system has been
started.
-
70028 The files from the RAM have been copied in the
Flash memory.
The files from the RAM have been copied in the
Flash memory. Following a restart, these saved
files are copied back to the RAM file system.
-
70029 Backup of the RAM file system has failed.
No backup copy of the RAM file system has been
made.
Check the settings in the "Control Panel > OP" dialog and
save the RAM file system using the "Save Files" button in
the "Persistent Storage" tab.
70030 The parameters configured for the system function
are faulty.
The connection to the new controller was not
established.
Compare the parameters configured for the system
function with the parameters configured for the controllers
and correct them as necessary.
70031 The controller configured in the system function is
not an S7 controller.
The connection to the new controller was not
established.
Compare the S7 controller name parameter configured
for the system function with the parameters configured for
the controller and correct them as necessary.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 155
Number Effect/cause Remedy
70032 The object configured with this number in the tab
order is not available in the selected screen.
The screen changes but the focus is set to the first
object.
Check the number of the tab order and correct it if
necessary.
70033 An e-mail cannot be sent because a TCP/IP
connection to the SMTP server no longer exists.
This system alarm is generated only at the first
attempt. All subsequent unsuccessful attempts to
send an e-mail will no longer generate a system
alarm. The event is regenerated when an e-mail
has been successfully sent in the meantime.
The central e-mail component in WinCC flexible
Runtime attempts, in regular intervals (1 minute), to
establish the connection to the SMTP server and to
send the remaining e-mails.
Check the network connection to the SMTP server and
re-establish it if necessary.
70034 Following a disruption, the TCP/IP connection to
the SMTP server could be re-established.
The queued e-mails are then sent.
-
70035 The e-mail queue of the central component in
WinCC flexible Runtime responsible for sending
e-mails is full. The e-mail could therefore not be
entered into the queue and therefore not sent.
The cause may be a broken connection to the
SMTP server or an overload resulting from too
much e-mail traffic.
This system alarm is generated only at the first
attempt. The next system alarm is only generated
when at least one e-mail has been successfully
sent to the queue in the meantime.
Check if
• the network connection still exists or
• the connection is overloaded (for example, due to
reoccurring system alarms resulting from disruptions).
70036 No SMTP server for sending e-mails is configured.
An attempt to connect to an SMTP server has failed
and it is not possible to send e-mails.
WinCC flexible Runtime generates the system
alarm after the first attempt to send an e-mail.
Configure an SMTP server:
In WinCC flexible Engineering System
using "Device settings > Device settings"
In the Windows CE operating system
using "Control Panel > Internet Settings > E-mail > SMTP
Server"
70037 An e-mail cannot be sent for unknown reasons.
The contents of the e-mail are lost.
Check the e-mail parameters (recipient etc.).
70038 The SMTP server has rejected sending or
forwarding an e-mail because the domain of the
recipient is unknown to the server or because the
SMTP server requires authentication.
The contents of the e-mail are lost.
Check the domain of the recipient address or deactivate
the authentication on the SMTP server if possible. SMTP
authentication is currently not used in WinCC flexible
Runtime.
70039 The syntax of the e-mail address is incorrect or
contains illegal characters.
The contents of the e-mail are discarded.
Check the e-mail address of the recipient.
70040 The syntax of the e-mail address is incorrect or
contains illegal characters.
-
80001 The log specified is filled to the size defined (in
percent) and must be stored elsewhere.
Store the file or table by executing a ‘move’ or ‘copy’
function.
80002 A line is missing in the specified log. -
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
156 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
80003 The copying process for logging was not
successful.
In this case, it is advisable to check any
subsequent system alarms, too.
-
80006 Since logging is not possible, this causes a
permanent loss of the functionality.
In the case of databases, check if the corresponding data
source exists and start up the system again.
80009 A copying action has been completed successfully. -
80010 Since the storage location was incorrectly entered
in WinCC flexible, this causes a permanent loss of
the functionality.
Configure the storage location for the respective log
again and restart the system when the full functionality is
required.
80012 Log entries are stored in a buffer. If the values are
read to the buffer faster than they can be physically
written (using a hard disk, for example),
overloading may occur and recording is then
stopped.
Archive fewer values.
Or:
Increase the logging cycle.
80013 The overload status no longer applies. Archiving
resumes the recording of all values.
-
80014 The same action was triggered twice in quick
succession. Since the process is already in
operation, the action is only carried out once.
-
80015 This system alarm is used to report DOS or
database errors to the user.
-
80016 The logs are separated by the system function
"CloseAllLogs" and the incoming entries exceed the
defined buffer size.
All entries in the buffer are deleted.
Reconnect the logs.
80017 The number of incoming events cause a buffer
overflow. his can be caused, for example, by
several copying actions being activated at the same
time.
All copy jobs are deleted.
Stop the copy action.
80018 All connections between WinCC flexible and the
logs have been reestablished, for example, after
executing the system function "OpenAllLogs".
Entries are written into the logs again.
-
80019 The connection between WinCC flexible and all
logs were closed, for example, after executing the
system function "CloseAllLogs".
Entries are written to the buffer and are then written
to the logs when a connection is re-established.
There is no connection to the storage location and
the storage medium may be replaced, for example.
-
80020 The maximum number of simultaneously copy
operations has been exceeded. Copying is not
executed.
Wait until the current copying actions have been
completed, then restart the last copy action.
80021 An attempt was made to delete a log which is still
busy with a copy action. Deletion has not been
executed.
Wait until the current copying actions have been
completed, then restart the last action
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 157
Number Effect/cause Remedy
80022 An attempt was made to start a sequence log,
which is not a sequence log, from a log using the
system function "StartSequenceLog". No sequence
log file is created.
In the project, check
• if the "StartSequenceLog" system function was
properly configured
• if the tag parameters are properly provided with data
on the HMI device
80023 An attempt was made to copy a log to itself.
The log is not copied.
In the project, check
• if the "CopyLog" system function was properly
configured
• if the tag parameters are properly provided with data
on the HMI device
80024 The "CopyLog" system function does not allow
copying when the target log already contains data
("Mode" parameter). The log is not copied.
Edit the "CopyLog" system function in the project if
necessary. Before you initiate the system function, delete
the destination log file.
80025 You have canceled the copy operation.
Data written up to this point are retained. The
destination log file (if configured) is not deleted.
The cancellation is reported by an error entry
$RT_ERR$ at the end of the destination log.
-
80026 This alarm is output after all logs are initialized.
Values are written to the logs from then on. Prior to
this, no entries are written to the logs, irrespective
whether WinCC flexible Runtime is active or not.
-
80027 The internal Flash memory has been specified as
the storage location for a log. This is not
permissible.
No values are written to this log and the log file is
not created.
Configure "Storage Card" or a network path as the
storage location.
80028 The alarm returns a status report indicating that the
logs are currently being initialized. No values are
logged until the alarm 80026 is output.
-
80029 The number of logs specified in the alarm could not
be initialized. The logs are initialized.
The faulty log files are not available for logging
jobs.
Evaluate the additional system alarms , related to this
alarm which is also generated.
Check the configuration, the ODBC (Open Database
Connectivity) and the specified drive.
80030 The structure of the existing log file does not match
the expected structure.
Logging is stopped for this log.
Delete the existing log data manually, in advance.
80031 The log in CSV format is corrupted.
The log cannot be used.
Delete the faulty file.
80032 Logs can be assigned events. These are triggered
as soon as the log is full. If WinCC flexible Runtime
is started and the log is already full, the event is not
triggered.
The log specified no longer logs data because it is
full.
Close WinCC flexible Runtime, delete the log, then restart
WinCC flexible Runtime.
Or:
Configure a button which contains the same actions as
the event and press it.
80033 "System Defined" is set in the data log file as the
data source name. This causes an error. No data is
written to the database logs, whereas the logging to
the CSV logs works.
Install MSDE again.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
158 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
80034 An error has occurred in the initialization of the
logs. An attempt has been made to create the
tables as a backup. This action was successful. A
backup has been made of the tables of the
corrupted log file and the cleared log was restarted.
No action is necessary. However, it is recommended to
save the backup files or delete them in order to make the
space available again.
80035 An error has occurred in the initialization of the
logs. An attempt has been made to create backups
of the tables and this has failed. No logging or
backup has been performed.
It is recommended to save the backups or to delete them
in order to release memory.
110000 The operating mode was changed. "Offline" mode
is now set.
-
110001 The operating mode was changed. "Online" mode
is now set.
-
110002 The operating mode was not changed. Check the connection to the controllers.
Check if the address area for the area pointer 88
“Coordination" in the controller is available.
110003 The operating mode of the specified controller was
changed by the system function
"SetConnectionMode".
The operating mode is now "offline".
-
110004 The operating mode of the specified controller has
been changed by the system function
"SetConnectionMode".
The operating mode is now "online".
-
110005 An attempt was made to use the system function
SetConnectionMode to switch the specified
controller to "online" mode, although the entire
system is in "offline" mode. This changeover is not
allowed. The controller remains in "offline" mode.
Switch the complete system to "online" mode, then
execute the system function again.
110006 The content of the "project version" area pointer
does not match the user version configured in
WinCC flexible. WinCC flexible Runtime is
therefore closed.
Check:
• the project version entered on the controller
• the project version entered in WinCC flexible
120000 The trend is not shown because you configured an
incorrect axis to the trend or an incorrect trend.
Change the configuration.
120001 The trend is not shown because you configured an
incorrect axis to the trend or an incorrect trend.
Change the configuration.
120002 The trend is not displayed because the tag
assigned attempts to access an invalid controller
address.
Check if the data area for the tag exists in the controller,
the configured address is correct and the value range for
the tag is correct.
130000 The action was not executed. Close all other programs.
Delete files no longer required from the hard disk.
130001 The action was not executed. Delete files no longer required from the hard disk.
130002 The action was not executed. Close all other programs.
Delete files no longer required from the hard disk.
130003 No data medium found. The operation is canceled. Check, for example, if
• the correct data medium is being accessed
• the data medium is inserted
130004 The data medium is write-protected. The operation
is canceled.
Check if access has been made to the correct data
carrier. Remove the write protection.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 159
Number Effect/cause Remedy
130005 The file is read only. The operation is canceled. Check if access has been made to the correct file. Edit
the file attributes if necessary.
130006 Access to file failed. The operation is canceled. Check, for example, if
• the correct file is being accessed
• the file exists
• another action is preventing simultaneous access to
the file
130007 The network connection is interrupted.
Data records cannot be saved or read over the
network connection.
Check the network connection and eliminate the cause of
error.
130008 The storage card is not available.
Data records cannot be saved to / read from the
storage card.
Insert the storage card.
130009 The specified folder does not exist on the storage
card.
Any files saved to this directory are not backed up
when you switch off the HMI device.
Insert the storage card.
130010 The maximum nesting depth can be exhausted
when, for example, a value change in a script
results in the call of another script and the second
script in turn has a value change that results in the
call of yet a further script etc.
The configured functionality is not supported.
Check the configuration.
140000 An online connection to the controller is
established.
-
140001 The online connection to the controller was shut
down.
-
140003 No tag updating or writing is executed. Check the connection and if the controller is switched on.
Check the parameter definitions in the Control Panel
using "Set PG/PC interface".
Restart the system.
140004 No tag update or write operations are executed
because the access point or the module
configuration is faulty.
Verify the connection and check if the controller is
switched on.
Check the access point or the module configuration (MPI,
PPI, PROFIBUS) in the Control Panel with "Set PG/PC
interface".
Restart the system.
140005 No tag updating or writing is executed because the
HMI device address is incorrect (possibly too high).
Use a different HMI device address.
Verify the connection and check ifthe controller is
switched on.
Check the parameter definitions in the Control Panel
using "Set PG/PC interface".
Restart the system.
140006 No tag updating or writing is executed because the
baud rate is incorrect.
Select a different baud rate in WinCC flexible (according
to module, profile, communication peer, etc.).
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
160 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
140007 Tag are not updated or written because the bus
profile is incorrect (see %1).
The following parameter could not be written to the
registry::
1: Tslot
2: Tqui
3: Tset
4: MinTsdr
5: MaxTsdr
6: Trdy
7: Tid1
8: Tid2
9: Gap Factor
10: Retry Limit
Check the user-defined bus profile.
Check the connection and if the controller is switched on.
Check the parameter definitions in the Control Panel
using "Set PG/PC interface".
Restart the system.
140008 No tag updating or writing is executed because
baud rate is incorrect. The following parameters
could not be written to the registry:
0: General error
1: Wrong version
2: Profile cannot be written to the registry.
3: The subnet type cannot be written to the
registry.
4: The Target Rotation Time cannot be written to
the registry.
5: Faulty Highest Address (HSA).
Check the connection and if the controller is switched on.
Check the parameter definitions in the Control Panel
using "Set PG/PC interface".
Restart the system.
140009 Tags are not updated or written because the
module for S7 communication was not found.
Reinstall the module in the Control Panel using "Set
PG/PC interface".
140010 No S7 communication partner found because the
controller is shut down.
DP/T:
The option “PG/PC is the only master” is not set in
the Control Panel under “Set PG/PC interface.”
Switch the controller on.
DP/T:
If only one master is connected to the network, disable
"PG/PC is the only master" in "Set PG/PC interface".
If several masters are connected to the network, enable
these. Do not change any settings, for this will cause bus
errors.
140011 No tag updating or writing is executed because
communication is down.
Check the connection and that the communication
partner is switched on.
140012 There is an initialization problem (e.g. when WinCC
flexible Runtime was closed in Task Manager).
Or:
Another application (e.g.STEP7) with different bus
parameters is active and the driver cannot be
started with the new bus parameters (transmission
rate, for example).
Restart the HMI device.
Or:
Run WinCC flexible Runtime, then start your other
applications.
140013 The MPI cable is disconnected and, thus, there is
no power supply.
Check the connections.
140014 The configured bus address is in already in use by
another application.
Edit the HMI device address in the controller
configuration.
140015 Wrong transmission rate
Or:
Faulty bus parameters (e.g.HSA)
Or:
OP address > HSA or: Wrong interrupt vector
(interrupt does not arrive at the driver)
Correct the relevant parameters.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 161
Number Effect/cause Remedy
140016 The hardware does not support the configured
interrupt.
Change the interrupt number.
140017 The set interrupt is in use by another driver. Change the interrupt number.
140018 The consistency check was disabled by SIMOTION
Scout. Only a corresponding note appears.
Enable the consistency check with SIMOTION Scout and
once again download the project to the PLC.
140019 SIMOTION Scout is downloading a new project to
the controller. Connection to the controller is
canceled.
Wait until the end of the reconfiguration.
140020 The version in the controller and that of the project
(FWX file) do not match.
Connection to the controller is canceled
The following remedies are available:
Download the current version to the PLC using
SIMOTION Scout.
Regenerate the project using WinCC flexible ES, close
WinCC flexible Runtime and restart with a new
configuration.
150000 No more data is read or written. Possible causes:
• The cable is defective.
• The PLC does not respond, is defective, etc.
• The wrong port is used for the connection.
• System overload.
Ensure that the cable is plugged in, the controller is
operational, the correct interface is being used.
Restart the system if the system alarm persists.
150001 Connection is up because the cause of the
interruption has been eliminated.
-
160000 No more data is read or written. Possible causes:
• The cable is defective.
• The PLC does not respond, is defective, etc.
• The wrong port is used for the connection.
• System overload.
Ensure that the cable is plugged in, the controller is
operational, the correct interface is being used.
Restart the system if the system alarm persists.
160001 Connection is up because the cause of the
interruption has been eliminated.
-
160010 No connection to the server because the server
identification (CLS-ID) cannot be determined.
Values cannot be read or written.
Check access rights.
160011 No connection to the server because the server
identification (CLS-ID) cannot be determined.
Values cannot be read or written.
Check, for example, if
• the server name is correct
• the computer name is correct
• the server is registered
160012 No connection to the server because the server
identification (CLS-ID) cannot be determined.
Values cannot be read or written.
Check, for example, if
• the server name is correct
• the computer name is correct
• the server is registered
Note for advanced users:
Interpret the value from HRESULT.
160013 The specified server was started as InProc server.
This has not been released and may possibly lead
to incorrect behavior because the server is running
in the same process area as the WinCC flexible
Runtime software.
Configure the server as OutProc Server or Local Server.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
162 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
160014 Only one OPC server project can be started on a
PC/MP. An alarm is output when an attempt is
made to start a second project.
The second project has no OPC server functionality
and cannot be located as an OPC server by
external sources.
Do not start a second project with OPC server
functionality on the computer.
170000 S7 diagnostics events are not indicated because it
is not possible to log on to the S7 diagnostics
functions at this device. The service is not
supported.
-
170001 The S7 diagnostics buffer cannot be viewed
because communication with the controller is shut
down.
Set the controller to online mode.
170002 The S7 diagnostics buffer cannot be viewed
because reading of the diagnostics buffer (SSL)
was canceled with error.
-
170003 An S7 diagnostics event cannot be visualized. The
system returns internal error %2.
-
170004 An S7 diagnostics event cannot be visualized. The
system returns an internal error of error class %2,
error number %3.
-
170007 It is not possible to read the S7 diagnostics buffer
(SSL) because this operation was canceled with an
internal error of class %2 and error code %3.
-
180000 A component/OCX received configuration data with
a version ID which is not supported.
Install a newer component.
180001 System overload because too many actions
running in parallel. Not all the actions can be
executed, some are rejected.
Several remedies are available:
• Increase the configured cycle times or basic clock.
• Generate the alarms at a slower rate (polling).
• Initiate scripts and functions at greater intervals.
If the alarm appears more frequently:
Restart the HMI device.
180002 The on-screen keyboard could not be activated.
Possible causes:
"TouchInputPC.exe" was not registered due to a
faulty Setup.
Reinstall WinCC flexible Runtime.
190000 It is possible that the tag is not updated. -
190001 The tag is updated after the cause of the last error
state has been eliminated (return to normal
operation).
-
190002 The tag is not updated because communication
with the controller is down.
Select the system function "SetOnline" to go online.
190004 The tag is not updated because the configured tag
address does not exist.
Check the configuration.
190005 The tag is not updated because the configured
controller type does not exist for this tag.
Check the configuration.
190006 The tag is not updated because it is not possible to
map the controller type in the data type of the tag.
Check the configuration.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 163
Number Effect/cause Remedy
190007 The tag value is not modified because the
connection to the controller is interrupted or the tag
is offline.
Set online mode or reconnect to the controller.
190008 The threshold values configured for the tag have
been violated, for example, by
• a value entered
• a system function
• a script
Observe the configured or current threshold values of the
tag.
190009 An attempt has been made to assign the tag a
value which is outside the permitted range of
values for this data type.
For example, a value of 260 was entered for a byte
tag or a value of -3 for an unsigned word tag.
Observe the range of values for the data type of the tags.
190010 Too many values are written to the tag (for
example, in a loop triggered by a script).
Values are lost because only up to 100 actions are
saved to the buffer.
Increase the time interval between multiple write actions.
190011 Possible cause 1:
The value entered could not be written to the
configured controller tag because the high or low
limit was exceeded.
The system discards the entry and restores the
original value.
Possible cause 2:
The connection to the controller was interrupted.
Make sure that the value entered lies within the range of
values of the control tags.
Check the connection to the PLC.
190012 It is not possible to convert a value from a source
format to a target format, for example:
An attempt is being made to assign a value to a
counter that is outside the valid, PLC-specific value
range.
A tag of the type Integer should be assigned a
value of the type String.
Check the range of values or the data type of the tags.
190100 The area pointer is not updated because the
address configured for this pointer does not exist.
Type
1 Warning alarms
2 Error alarms
3 Controller acknowledgment
4 HMI device acknowledgment
5 LED mapping
6 Trend request
7 Trend transfer 1
8 Trend transfer 2
No.:
consecutive number shown in WinCC flexible ES.
Check the configuration.
190101 The area pointer is not updated because it is not
possible to map the PLC type to the area pointer
type.
Parameter type and no.:
see alarm 190100
-
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
164 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
190102 The area pointer is updated after the cause of the
last error state has been eliminated (return to
normal operation). Parameter type and no.: See
alarm 190100.
-
200000 Coordination is not executed because the address
configured in the controller does not exist/is not set.
Change the address or set up the address in the
controller.
200001 Coordination is canceled because the write access
to the address configured in the PLC is not
possible.
Change the address or set the address in the controller at
an area which allows write access.
200002 Coordination is not carried out at the moment
because the address format of the area pointer
does not match the internal storage format.
Internal fault
200003 Coordination can be executed again because the
last error state is eliminated (return to normal
operation).
-
200004 The coordination may not be executed. -
200005 No more data is read or written. Possible causes:
• The cable is defective.
• The PLC does not respond, is defective, etc.
• System overload.
Ensure that the cable is plugged in and the controller is
operational.
Restart the system if the system alarm persists.
200100 Coordination is not executed because the address
configured in the controller does not exist/is not set.
Change the address or set up the address in the
controller.
200101 Coordination is canceled because the write access
to the address configured in the PLC is not
possible.
Change the address or set the address in the controller at
an area which allows write access.
200102 Coordination is not carried out at the moment
because the address format of the area pointer
does not match the internal storage format.
Internal fault
200103 Coordination can be executed again because the
last error state is eliminated (return to normal
operation).
-
200104 The coordination may not be executed. -
200105 No more data is read or written. Possible causes:
• The cable is defective.
• The PLC does not respond, is defective, etc.
• System overload.
Ensure that the cable is plugged in and the controller is
operational.
Restart the system if the system alarm persists.
210000 Jobs are not processed because the address
configured in the controller does not exist/has not
been set up.
Change the address or set up the address in the
controller.
210001 Jobs are not processed because read/write access
to the address configured in the controller is not
possible.
Change the address or set up the address in the
controller in an area which allows read/write access.
210002 Jobs are not executed because the address format
of the area pointer does not match the internal
storage format.
Internal fault
210003 The job buffer is processed again because the last
error status has been eliminated (return to normal
operation).
-
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 165
Number Effect/cause Remedy
210004 It is possible that the job buffer will not be
processed.
-
210005 A control request with an illegal number was
initiated.
Check the controller program.
210006 An error occurred while attempting to execute the
control request. As a result, the control request is
not executed. Observe the next/previous system
alarms.
Check the parameters of the control request. Recompile
the configuration.
220001 The tag is not downloaded because the associated
communication driver / HMI device does not
support the download of Boolean/discrete data
types.
Change the configuration.
220002 The tag is not downloaded because the associated
communication driver / HMI device does not
support write access to the data type BYTE.
Change the configuration.
220003 The communication driver cannot be loaded. The
driver may not be installed.
Install the driver by reinstalling WinCC flexible Runtime.
220004 Communication is down and no update data is
transferred because the cable is not connected or
defective etc.
Check the connection.
220005 Communication is up. -
220006 The connection between the specified PLC and the
specified port is active.
-
220007 The connection to the specified controller is
interrupted at the specified port.
Check if
• the cable is plugged in
• the controller is OK
• the correct port is used
• the configuration is OK (interface parameters, protocol
settings, PLC address).
Restart the system if the system alarm persists.
220008 The communication driver cannot access or open
the specified port. The port may be in use by
another application or the port used is not available
on the destination device.
There is no communication with the controller.
Close all the applications which access this port and
restart the computer.
Use another port of the system.
230000 The value entered could not be accepted. The
entered value is discarded and the previous value
is restored.
Either the value range has been exceeded or
impermissible characters were entered.
Enter a permissible value.
230002 The currently logged on user is not granted write
access rights. The system therefore discards the
input and restored the previous value.
Log on as a user with appropriate rights.
230003 Changeover to the specified screen failed because
the screen is not available/configured. The current
screen remains selected.
Configure the screen and check the screen selection
function.
230005 The value range of the tag has been exceeded in
the IO field.
The original value of the tag is retained.
Observe the range of values for the tag when entering a
value.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
166 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
230100 During navigation in the web browser, the system
returned a message which may be of interest to the
user.
The web browser continues to run but may not
(fully) show the new page.
Navigate to another page.
230200 The connection to the HTTP channel was
interrupted due to an error. This error is explained
in detail by another system alarm.
Data is no longer exchanged.
Check the network connection.
Check the server configuration.
230201 The connection to HTTP channel was established.
Data is exchanged.
-
230202 WININET.DLL has detected an error. This error
usually occurs when an attempt to connect to the
server fails or the server refuses to connect
because the client lacks the proper authorization.
An unknown server certificate may also be the
cause if the connection is encrypted by means of
SSL.
The alarm text provides details.
This text is always in the language of the Windows
installation because it is returned by the Windows
OS.
Process values are no longer exchanged.
Depending on the cause:
When an attempt to connect fails or a timeout error
occurs:
• Check the network connection and the network.
• Check the server address.
• Check if the web server is actually running on the
destination computer.
Faulty authorization:
• The configured user name and/or password do not
match those on the server. Establish consistency.
When the server certificate is rejected:
Certificate signed by an unknown CA ( ):
• Either ignore this item in your project, or
• Install a certificate that has been signed with a root
certificate known to the client computer.
The date of the certificate is invalid:
• Either ignore this item in your project, or
• Install a certificate with a valid date on the server.
Invalid CN (Common Name or Computer Name):
• Either ignore this item in your project, or
• Install a certificate with a name that corresponds to
that of the server address.
230203 Although a connection can be made to the server,
the HTTP server refuses to connect because
• WinCC flexible Runtime is not running on the
server, or
• the HTTP channel is not supported
(503 Service unavailable).
Other errors can only occur if the web server does
not support the HTTP channel. The language of the
alarm text depends on the web server.
Data is not exchanged.
Error 503 Service unavailable: Check if
WinCC flexible Runtime is running on the server
the HTTP channel is supported.
230301 An internal error has occurred. An English text
explains the error in more detail. This may be
caused by insufficient memory.
OCX does not work.
-
230302 The name of the remote server cannot be resolved.
The attempt to connect failed.
Check the configured server address.
Check if the DNS service is available on the network.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 167
Number Effect/cause Remedy
230303 The remote server is not running on the addressed
computer.
Wrong server address.
The attempt to connect failed
Check the configured server address.
Check if the remote server is running on the target
computer.
230304 The remote server on the addressed computer is
incompatible to VNCOCX.
The attempt to connect failed.
Use a compatible remote server.
230305 The authentication has failed because the
password is incorrect.
The attempt to connect failed.
Configure the correct password.
230306 Error in the connection to the remote server. This
may occur as a result of network problems.
The attempt to connect failed.
Check if
• the bus cable is plugged in
• there are network problems
230307 The connection to the remote server was shut
down because
• the remote server was shut down, or
• the user instructed the server to close all
connections.
The connection is closed.
-
230308 This alarm provides information on the connection
status.
An attempt is made to connect.
-
240000 WinCC flexible Runtime is operating in demo mode.
You have no authorization or your authorization is
corrupted.
Install the authorization.
240001 WinCC flexible Runtime is operating in demo mode.
Too many tags are configured for the installed
version.
Load an adequate authorization / powerpack.
240002 WinCC flexible Runtime is operating with a time-
limited emergency authorization.
Restore the full authorization.
240003 Authorization failed.
Without authorization, WinCC will run in demo
mode.
Restart WinCC flexible Runtime or reinstall it.
240004 Error while reading the emergency authorization.
WinCC flexible Runtime is operating in demo mode.
Restart WinCC flexible Runtime, install the authorization
or repair the authorization (see Commissioning
Instructions Software Protection).
250000 The tag in the specified line in "Status force" is not
updated because the address configured for this
tag is not available.
Check the set address and then verify that the address is
set up in the controller.
250001 The tag in the specified line in "Status force" is not
updated because the controller type configured for
this tag does not exist.
Check the set address.
250002 The tag in the specified line in "Status force" is not
updated because it is not possible to map the
controller type in the tag type.
Check the set address.
250003 An attempt to connect to the PLC failed. The tags
are not updated.
Check the connection to the PLC. Check that the
controller is switched on and is online.
260000 An unknown user or an unknown password has
been entered in the system.
The current user is logged off from the system.
Log on to the system as a user with a valid password.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
168 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
260001 The logged on user does not have sufficient
authorization to execute the protected functions on
the system.
Log on to the system as a user with sufficient
authorization.
260002 This alarm is triggered by the system function
"TrackUserChange".
-
260003 The user has logged off from the system. -
260004 The user name entered into the user view already
exists in the user administration.
Select another user name because user names have to
be unique in the user administration.
260005 The entry is discarded. Use a shorter user name.
260006 The entry is discarded. Use a shorter or longer password.
260007 The logon timeout value entered is outside the valid
range of 0 to 60 minutes.
The new value is discarded and the original value is
retained.
Enter a logon timeout value between 0 and 60 minutes.
260008 An attempt was made to read a PTProRun.pwl file
created with ProTool V 6.0 in WinCC flexible.
Reading the file was canceled due to incompatibility
of the format.
-
270000 A tag is not indicated in the alarm because it
attempts to access an invalid address in the
controller.
Check if the data area for the tag exists in the controller,
the configured address is correct and the value range for
the tag is correct.
270001 There is a device-specific limit as to how many
alarms may be queued for output (see the
operating instructions). This limit has been
exceeded.
The view no longer contains all the alarms.
However, all alarms are written to the alarm buffer.
-
270002 The view shows alarms of a log for which there is
no data in the current project.
Wildcards are output for the alarms.
Delete older log data if necessary.
270003 The service cannot be set up because too many
devices want to use this service.
A maximum of four devices may execute this
action.
Reduce the number of HMI devices which want to use the
service.
280000 Connection is up because the cause of the
interruption has been eliminated.
-
280001 No more data is read or written. Possible causes:
• The cable is defective.
• The PLC does not respond, is defective, etc.
• The wrong port is used for the connection.
• System overload.
Check if
• the cable is plugged in
• the controller is OK
• the correct port is used
Restart the system if the system alarm persists.
280002 The connection used requires a function block in
the controller.
The function block has responded. Communication
is now enabled.
-
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 169
Number Effect/cause Remedy
280003 The connection used requires a function block in
the controller.
The function block has not responded.
Check if
• the cable is plugged in
• the controller is OK
• the correct port is used
Restart the system if the system alarm persists.
Remedy depends on the error code:
1: The function block must set the COM bit in the
response container.
2: The function block must not set the ERROR bit in the
response container.
3: The function block must respond within the specified
time (timeout).
4: Go online to the PLC.
280004 The connection to the controller is interrupted.
There is no data exchange at present.
Check the connection parameters in WinCC flexible.
Ensure that the cable is plugged in, the controller is
operational, the correct interface is being used.
Restart the system if the system alarm persists.
290000 The recipe tag could not be read or written. It is
assigned the start value.
The alarm can be entered in the alarm buffer for up
to four more failed tags if necessary. After that,
alarm 290003 is output.
Check in the configuration that the address has been set
up in the controller.
290001 An attempt has been made to assign a value to a
recipe tag which is outside the value range
permitted for this type.
The alarm can be entered in the alarm buffer for up
to four more failed tags if necessary. After that,
alarm 290004 is output.
Observe the value range for the tag type.
290002 It is not possible to convert a value from a source
format to a target format.
The alarm can be entered in the alarm buffer for up
to four more failed recipe tags if necessary. After
that, alarm 290005 is output.
Check the value range or type of the tag.
290003 This alarm is output when alarm number 290000 is
triggered more than five times.
In this case, no further separate alarms are
generated.
Check in the configuration that the tag addresses have
been set up in the controller.
290004 This alarm is output when alarm number 290001 is
triggered more than five times.
In this case, no further separate alarms are
generated.
Observe the value range for the tag type.
290005 This alarm is output when alarm number 290002 is
triggered more than five times.
In this case, no further separate alarms are
generated.
Check the value range or type of the tag.
290006 The threshold values configured for the tag have
been violated by values entered.
Observe the configured or current threshold values of the
tag.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
170 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
290007 There is a difference between the source and target
structure of the recipe currently being processed.
The target structure contains an additional data
recipe tag which is not available in the source
structure.
The data recipe tag specified is assigned its start
value.
Insert the specified data recipe tag in the source
structure.
290008 There is a difference between the source and target
structure of the recipe currently being processed.
The source structure contains an additional data
recipe tag which is not available in the target
structure and therefore cannot be assigned.
The value is rejected.
Remove the specified data recipe tag in the specified
recipe from the project.
290010 The storage location configured for the recipe is not
permitted.
Possible causes:
Illegal characters, write protection, data carrier out
of space or does not exist.
Check the configured storage location.
290011 The data record with the specified number does not
exist.
Check the source for the number (constant or tag value).
290012 The recipe with the specified number does not
exist.
Check the source for the number (constant or tag value).
290013 An attempt was made to save a data record under
a data record number which already exists.
The action is not executed.
The following remedies are available:
• Check the source for the number (constant or tag
value).
• First, delete the data record.
• Change the "Overwrite" function parameter.
290014 The file specified to be imported could not be
found.
Check:
• The file name
• Ensure that the file is in the specified directory.
290020 Message reporting that the download of data
records from the HMI device to the PLC has
started.
-
290021 Message reporting that the download of data
records from the HMI device to the PLC was
completed.
-
290022 Message reporting that the download of data
records from the HMI device to the PLC was
canceled due to an error.
Check in the configuration whether:
• The tag addresses are configured in the controller
• The recipe number exists
• The data record number exist
• The "Overwrite" function parameter is set
290023 Message reporting that the download of data
records from the PLC to the HMI device has
started.
-
290024 Message reporting that the download of data
records from the PLC to the HMI device was
completed.
-
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 171
Number Effect/cause Remedy
290025 Message reporting that the download of data
records from the PLC to the HMI device was
canceled due to an error.
Check in the configuration whether:
• The tag addresses are configured in the controller
• The recipe number exists
• The data record number exist
• The "Overwrite" function parameter is set
290026 An attempt has been made to read/write a data
record although the data record is not free at
present.
This error may occur in the case of recipes for
which downloading with synchronization has been
configured.
Set the data record status to zero.
290027 Unable to connect to the controller at present. As a
result, the data record can neither be read nor
written.
Possible causes:
No physical connection to the controller (no cable
plugged in, cable is defect) or the controller is
switched off.
Check the connection to the PLC.
290030 This alarm is output after you selected screen
which contains a recipe view in which a data record
is already selected.
Reload the data record from the storage location or retain
the current values.
290031 While saving, it was detected that a data record
with the specified number already exists.
Overwrite the data record or cancel the action.
290032 While exporting data records it was detected that a
file with the specified name already exists.
Overwrite the file or cancel the process.
290033 Confirmation request before deleting data records. -
290040 A data record error with error code %1 that cannot
be described in more detail occurred.
The action is canceled.
It is possible that the data record was not installed
correctly on the controller.
Check the storage location, the data record, the "Data
record" area pointer and if necessary, the connection to
the controller.
Restart the action after a short time.
If the error persists, contact Customer Support. Forward
the relevant error code to Customer Support.
290041 A data record or file cannot be saved because the
storage location is full.
Delete files no longer required.
290042 An attempt was made to execute several recipe
actions simultaneously. The last action was not
executed.
Trigger the action again after waiting a short period.
290043 Confirmation request before storing data records. -
290044 The data store for the recipe has been destroyed
and is deleted.
-
290050 Message reporting that the export of data records
has started.
-
290051 Message reporting that the export of data records
was completed.
-
290052 Message reporting that the export of data records
was canceled due to an error.
Ensure that the structure of the data records at the
storage location and the current recipe structure on the
HMI device are identical.
290053 Message reporting that the import of data records
has started.
-
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
172 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
290054 Message reporting that the import of data records
was completed.
-
290055 Message reporting that the import of data records
was canceled due to an error.
Ensure that the structure of the data records at the
storage location and the current recipe structure on the
HMI device are identical.
290056 Error when reading/writing the value in the
specified line/column.
The action was canceled.
Check the specified line/column.
290057 The tags of the recipe specified were toggled from
"offline" to "online" mode.
Each change of a tag in this recipe is now
immediately downloaded to the controller.
-
290058 The tags of the specified recipe were toggled from
"offline" to "online" mode.
Modifications to tags in this recipe are no longer
immediately transferred to the controller but must
be transferred there explicitly by downloading a
data record.
-
290059 Message reporting that the specified data record
was saved.
-
290060 Message reporting that the specified data record
memory was cleared.
-
290061 Message reporting that clearing of data record
memory was canceled due to an error.
-
290062 The data record number is above the maximum of
65536.
This data record cannot be created.
Select another number.
290063 This occurs with the system function
"ExportDataRecords" when the parameter
"Overwrite" is set to No.
An attempt has been made to save a recipe under
a file name which already exists.
The export is canceled.
Check the "ExportDataRecords" system function.
290068 Request to confirm if all data records in the recipe
should be deleted.
-
290069 Request to confirm if all data records of all recipes
should really be deleted.
-
290070 The data record specified is not in the import file. Check the source of the data record number or data
record name (constant or tag value).
290071 During the editing of data record values, a value
was entered which exceeded the low limit of the
recipe tag.
The entry is discarded.
Enter a value within the limits of the recipe tag.
290072 When editing data record values, a value was
entered which exceeds the high limit of the recipe
tag.
The entry is discarded.
Enter a value within the limits of the recipe tag.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 173
Number Effect/cause Remedy
290073 An action (e.g. saving a data record) failed due to
an unknown error.
The error corresponds to the status alarm
IDS_OUT_CMD_EXE_ERR in the large recipe
view.
-
290074 While saving, it was detected that a data record
with the specified number already exists but under
another name.
Overwrite the data record, change the data record
number or cancel the action.
290075 A data record with this name already exists.
The data record is not saved.
Please select a different data record name.
300000 Faulty configuration of process monitoring (e.g.
using PDiag or S7-Graph): More alarms are
queued than specified in the specifications of the
CPU. No further ALARM_S alarms can be
managed by the PLC and reported to the HMI
devices.
Change the controller configuration.
300001 ALARM_S is not registered on this controller. Select a controller that supports the ALARM_S service.
310000 An attempt is being made to print too many reports
in parallel.
Only one log file can be output to the printer at a
given time; the print job is therefore rejected.
Wait until the previous active log was printed.
Repeat the print job if necessary.
310001 An error occurred on triggering the printer. The
report is either not printed or printed with errors.
Evaluate the additional system alarms related to this
alarm.
Repeat the print job if necessary.
320000 The movements have already been indicated by
another device.
The movements can no longer be controlled.
Deselect the movements on the other display units and
select the motion control screen on the required display
unit.
320001 The network is too complex.
The faulty addresses cannot be indicated.
View the network in STL.
320002 No diagnostics alarm selected.
The unit belonging to the alarm could not be
selected.
Select a diagnostics alarm from the ZP_ALARM alarm
screen.
320003 No alarms exists for the selected unit. The detail
view cannot visualize any networks.
Select the defective unit from the overview screen.
320004 The required signal states could not be read by the
PLC. The faulty addresses cannot be found.
Check the consistency between the configuration on the
display unit and the PLC program.
320005 The project contains ProAgent elements which are
not installed. ProAgent diagnostic functions cannot
be performed.
In order to run the project, install the optional ProAgent
package.
320006 You have attempted to execute a function which is
not supported in the current constellation.
Check the type of the selected unit.
320007 No error-triggering addresses were found on the
networks.
ProAgent cannot indicate any faulty addresses.
Switch the detail screen to STL layout mode and check
the status of the addresses and exclusion addresses.
320008 The diagnostic data stored in the configuration are
not synchronized with those in the PLC.
ProAgent can only indicate the diagnostic units.
Download the project to the HMI device again.
Appendix
A.2 System alarms
OP 73micro, TP 177micro (WinCC flexible)
174 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Number Effect/cause Remedy
320009 The diagnostic data stored in the configuration are
not synchronized with those in the PLC. The
diagnostic screens can be operated as usual.
ProAgent may be unable to show all diagnostic
texts.
Download the project to the HMI device again.
320010 The diagnostic data stored in the configuration are
not synchronized with those in STEP7.
The ProAgent diagnostics data is not up-to-date.
Download the project to the HMI device again.
320011 A unit with the corresponding DB number and FB
number does not exist.
The function cannot be executed.
Check the parameters of the "SelectUnit" function and the
units selected in the project.
320012 The "Step sequence mode" dialog is no longer
supported.
Use the ZP_STEP step sequence screen from the
corresponding standard project for your project. Instead
of calling the Overview_Step_Sequence_Mode function,
call the "FixedScreenSelection" function using ZP_STEP
as the screen name.
320014 The selected controller cannot be evaluated for
ProAgent.
The alarm view assigned to the
"EvaluateAlarmDisplayFault" system function could
not be found.
Check the parameters of the "EvaluateAlarmDisplayFault"
system function.
330022 Too many dialogs open on the HMI device. Close all dialogs you do not require on the HMI device.
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 175
Abbreviations B
CPU Central Processing Unit
CSV Comma Separated Values
CTS Clear To Send
DC Direct Current
DCD Data Carrier Detect
DIL Dual-in-Line (electronic chip housing design)
DP Distributed I/O
DSN Data Source Name
DSR Data Set Ready
DTR Data Terminal Ready
EMC Electromagnetic Compatibility
EN European standard
ES Engineering System
ESD Electrostatic Discharge, the components and modules endangered by
such
ESD Electrostatic Sensitive Device
GND Ground
HF High Frequency
HMI Human Machine Interface
IEC International Electronic Commission
IF Interface
LED Light Emitting Diode
MMC Multi-Media Card
MOS Metal Oxide Semiconductor
MPI Multipoint Interface (SIMATIC S7)
MS Microsoft
MTBF Mean Time Between Failures
n. c. Not connected
OP Operator Panel
PC Personal Computer
PG Programming device
PLC Programmable Logic Controller
PPI Point to Point Interface (SIMATIC S7)
RAM Random Access Memory
RTS Request To Send
Abbreviations
OP 73micro, TP 177micro (WinCC flexible)
176 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
RxD Receive Data
SELV Safety Extra Low Voltage
SP Service pack
STN Super Twisted Nematic
Sub-D Subminiature D (plug)
TAB Tabulator
TCP/IP Transmission Control Protocol/Internet Protocol
TFT Thin Film Transistor
TxD Transmit Data
UL Underwriter’s Laboratory
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 177
Glossary
Acknowledge
Acknowledging an alarm confirms that you have noted it.
AG
Controller of the SIMATIC S5 series such as the AG S5-115U, for example
Alarm logging
Output of user-specific alarms to a printer, in parallel to their output to the HMI device
screen.
Alarm, acknowledging
Acknowledgement of an alarm confirms that it has been noted.
Alarm, activated
Moment at which an alarm is triggered by the controller or HMI device.
Alarm, deactivated
Moment at which the initiation of an alarm is reset by the controller.
Alarm, user-specific
A user-specific alarm can be assigned to one of the following alarm classes:
● Error
● Warning
● User-specific alarm classes
A user-specific alarm designates a certain operating status of the plant connected to the HMI
device via the controller.
AS
Controller of the SIMATIC S7 series such as a SIMATIC S7-300
Glossary
OP 73micro, TP 177micro (WinCC flexible)
178 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
AS 511
Protocol of the programming device interface of a SIMATIC S5 controller
Boot loader
Used to start the operating system. Automatically started when the HMI device is switched
on. A start screen appears during startup. After the operating system has been loaded, the
Loader opens.
Configuration computer
General term for programming devices (PGs) and PCs on which plant projects are created
using an engineering software.
Control request
Triggers a function via the controller.
Controller
General term for devices and systems with which the HMI device communicates, e.g.
SIMATIC S7.
Display duration
Defines whether and how long a system alarm is displayed on the HMI device.
EMC
Electromagnetic compatibility is the ability of electrical equipment to function properly in its
electromagnetic environment without influencing this environment.
Engineering software
Software for the creation of projects for process visualization – see also project, process
visualization and runtime software
Event
Functions are triggered by defined incoming events. Events can be configured. Events which
can be assigned to a button include "Press" and "Release", for example.
Fault time
Refers to the time interval between an activated and deactivated alarm.
Glossary
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 179
Field
Area reserved in configured screens for the input and output of values.
Flash memory
Non-volatile memory with EEPROM chips, used as mobile storage medium or as memory
module installed permanently on the motherboard.
Half brightness lifetime
Time period until the brightness degrades to 50% of its original value. The specified value is
dependent on the operating temperature.
Hardcopy
Output of the screen content to a printer.
HMI device image
File which can be transferred from the programming device to the HMI device. The HMI
device image contains the operating system and elements of the runtime software required
to run a project.
Infotext
Configured information on objects within a project. An alarm infotext, for example, may
contain information on the cause of the fault and troubleshooting routines.
IO field
Enables the input or output of values on the HMI device which are transferred to the
controller.
Notation
System consisting of characters, symbols and rules. In particular used to define the write
format of a programming language in data processing.
Object
Component of a project. Example: screen or alarm. Objects are used to view or enter texts
and values on the HMI device.
Operator control object
Component of a project which is used to enter values and trigger functions. A button, for
example, is an operator control object.
Glossary
OP 73micro, TP 177micro (WinCC flexible)
180 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Process visualization
Visualization of processes from the areas of production, logistics and services in text-based
and graphics format. Configured plant screens allow operator intervention in active plant
processes by means of the input and output data.
Project
Result of a configuration using an engineering software. The project normally contains
several screens with embedded system-specific objects, basic settings and alarms. The
project file of a project configured in WinCC flexible is saved under the file name extension
*.hmi.
You distinguish between the project on the configuration computer and that on an HMI
device. A project may be available in more languages on the configuration computer than
can be managed on the HMI device. The project on the configuration computer can also be
set up for different HMI devices. Only the project set up for a particular HMI device can be
transferred to that HMI device.
Project file
File which is generated based on a source file for a specific HMI device when the
configuration is completed. The project file is transferred to the corresponding HMI device
and is used to operate and monitor plants. Refer to Source file.
Recipe
Combination of tags forming a fixed data structure. The data structure configured can be
assigned data on the HMI device and is then referred to as a data record. The use of recipes
ensures that when a data record is downloaded, all the assigned data is transferred
synchronously to the controller.
Runtime software
Process visualization software which can be used to debug a project on a configuration
computer. Also refer to "Project" and "Engineering software".
Screen
Form of the visualization of all logically related process data for a plant. The visualization of
the process data can be supported by graphic objects.
Screen object
Configured object for operating and monitoring the system, e.g. a rectangle, an IO field or a
recipe view.
Softkey
Key on the HMI device which supports user-specific functions. A function is assigned to the
key in the configuration. The assignment of the keys may be specific to an active screen or
not.
Glossary
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 181
Source file
File from which various project files can be created, depending on the configuration. The
source file is not transferred and remains on the configuration computer.
The file name extension of a source file is *.hmi. Refer to Source file, compressed and
Project file.
Source file, compressed
Compressed form of the source file. Can be transferred in addition to the project file to the
corresponding HMI device. "Enable Upload" must be set in the project on the configuration
computer. The file extension of a compressed source file is *.pdz. The standard memory
location for a compressed source file is the external MMC. Refer to Source file.
To restore a source file, it is necessary to use the same WinCC flexible version which was
used to configure the project.
STEP 7
Programming software SIMATIC S7, SIMATIC C7 and SIMATIC WinAC controllers.
STEP 7 Micro/WIN
Programming software for controllers of the SIMATIC S7-200 series.
Symbolic IO field
Box for the input/output of a parameter. Contains a list of default entries from which one can
be selected.
System alarms
Assigned to the "System" alarm class. A system alarm refers to internal states on the HMI
device and the controller.
Tab order
In the configuration, this sets the sequence in which objects are focused on pressing the
<TAB> key.
Tag
Defined memory location to which values can be written to and read from. This can be done
from the controller or the HMI device. Based on whether the tag is interconnected with the
controller or not, we distinguish between "external" tags (process tags) and "internal" tags.
Transfer
The transfer of an executable project to the HMI device.
Glossary
OP 73micro, TP 177micro (WinCC flexible)
182 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
"Transfer" mode
HMI device operating mode, set to transfer an executable project from the configuration
computer to the HMI device.
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 183
Index
A
Accessories, 13
Accessory kit, 13
Acknowledging
Alarm, 131, 134
Error alarm, 134
Addressing
HMI device, 62
S7-200, 62
Alarm, 14, 127
Acknowledging, 131, 134
Editing, 131, 135
Infotext for, 129
Viewing, 128
Alarm buffer, 128
Alarm class, 128, 133
Layout, 129
Alarm event, 127
Alarm indicator, 130, 134
Alarm text
Long, 130
Alarm text window, 130, 133
Alarm view, 128, 132
Alarm window, 128, 132
Alphanumerical characters
Editing, 108
Entering, 107
Alphanumerical screen keyboard, 120
Alphanumerical value, 106
Alphanumerical values, 118
Editing, 120
Entering, 107, 120
Ambient temperatures
Impermissible, 33
Approvals, 18, 22
Area pointer
Configuring, 64
B
Backing up, 95, 96, 98
Using ProSave, 98
Using WinCC flexible, 96
Backup, 92
Bottom view, 13
Bottom view of OP 73micro, 12
C
Calibrating
Touch screen, 85
Call sequence
Characters, 108
Calling
Version information, 75
Character input
Using control keys, 107, 110
Characters
Call sequence, 108
Delete, 108
Inserting, 109
Cleaning agents, 137
Cleaning screen, 138
Locking an operator control object, 138
Clearance, 32, 36
OP 73micro, 32
Climatic
Storage conditions, 25
Transport conditions, 25
Communication
Configuring the connection, 61
Communication
Specifying the baud rate, 62
Communication drivers
Installing S7-200, 60
Communication partners
SIMATIC S7, 62
Communications principle
S7-200, 63
Conductor cross-section, 54
Configuration instructions
Communication in the network, 60
PROFIBUS, 60
Configuration phase, 89
Configure
Operating system, 71
Index
OP 73micro, TP 177micro (WinCC flexible)
184 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Configuring
Operating system, 80
Configuring communication
Software requirements, 60
Configuring the data channel, OP 73micro, 79
Connecting
Configuration computer, 53
Connection sequence, 40, 49
Equipotential bonding, 42, 51
HMI device, 40, 49
Connecting the configuration computer
Wiring diagram, 44, 53
Connecting the PLC
Wiring diagram, 44
Connecting the PLC
Wiring diagram, 53
Connecting the terminal block, 45, 54
Connection sequence, 40, 49
Connections
Number, 16
Contrast, 74
Editing, 82
Setting, 74
Control keys
For symbolic input, 107, 110
Control Panel, 81
Opening, 81
Password protection, 80
D
Data area date time
Structure, 65
Data channel
Configuring TP 177micro, 88
Disable OP73micro, 79
Disable TP 177micro, 88
Enable OP73micro, 79
Enable TP 177micro, 88
Data types, 63
Date and time, 106, 118
Entering, 111, 122
Date Time
Reading from the PLC, 64
Decimal places, 106, 118
Delay time
Editing, 82
Setting, 76
Deleting
Password, 78
Device Info, 74
Dialog
Bootloader, 46
Dialog entries
Editing, 72
Display, 143, 144
Display format, 106
E
EC declaration of conformity, 18
Electrostatic charge, 150
Enclosure, 144
Entering
Alphanumerical characters, 107
Alphanumerical value, 106
Alphanumerical values, 107, 118, 120
Date and time, 106, 111, 118, 122
Numerical characters, 107
Numerical value, 106
Numerical values, 107, 117, 119
Symbolic value, 106
Symbolic values, 118, 122
Equipotential bonding
Connecting, 42, 51
Installing, 43, 52
Requirements, 42, 51
Wiring diagram, 43, 52
Equipotential bonding cable, 42, 51
Error alarm
Acknowledging, 134
Acknowledgment by the PLC, 66
Acknowledgment on the HMI device, 67
Acknowledgment options, 66
Explosion protection
Labels, 20
F
Factory settings
Resetting to, 96
Feedback
Optical, 115
Field
Activate, 104
Navigating in the, 107
Format patterns, 117
Front view, 13
Front view of OP 73micro, 12
Function
Additional, 16
Function test, 47, 56
Index
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 185
H
Help indicator, 112
High frequency radiation, 17
HMI device
Bottom view, 13
Connecting, 40, 49
EMC-compliant installation, 23
Fixation, 31
Front view, 13
Initial startup, 90
Interfaces, 50
Mounting, 34
Mounting position, 33, 48
Recommissioning, 90
Side view, 13
Switching off, 56
Switching on, 46, 55
Testing, 46, 55
HMI device
switching off, 47
HMI device image
Querying the version, 84
HMI device information
OP 73micro, 74
TP 177micro, 84
Housing, 143
I
IF 1B, 146, 147
OP 73micro, 146
TP 177micro, 147
Info/Settings, 72
Infotext, 15
Viewing, 112, 123, 129, 133
Initial startup
HMI device, 90
Input, 143, 144
Alphanumerical, 109
Example, 109
Numerical, 109
Input on the HMI device
Using soft keys, 103
Using system keys, 104
Instructions
General, 20
Security, 17, 20
Working on the cabinet, 17
Interfaces, 41, 50
Interference
Pulse-shaped, 23
Sinusoidal, 24
L
Labeling
Approvals, 18
EC declaration of conformity, 18
Labels
Explosion protection, 20
Language
Setting, 105, 116
LEDs, 69
Limit value test, 106, 118
Lists
Navigating in, 104
Loader, 80
Navigating in the, 71
OP 73micro, 71
Location of the manufacturer, 22
Locking an operator control object, 138
Logging off, 113, 124
Logging on, 113, 124
Logoff time, 113, 124
Logon dialog, 113, 124
M
Maintenance, 137, 139
Manual transfer, 93
Mechanical
Storage conditions, 25
Transport conditions, 25
Memory, 143, 144
Menu
Info/Settings, 72
Settings, 75
Migration
Of OP3 projects, 91
Of TP 170A projects, 91
Of TP 170micro projects, 91
To OP 73micro, 91
To TP 177micro, 91
Monitor settings
Editing, 82
Mounting, 39
EMC-compliant, 23
HMI device, 34
Horizontal mounting, 34
Vertical mounting, 34
Mounting clamp, 31, 34
Mounting cut-out, 35
Dimensions, 31, 35
Preparing, 31, 35
Mounting position, 30, 48
HMI device, 33
Index
OP 73micro, TP 177micro (WinCC flexible)
186 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Mounting the HMI device
Mounting position, 30
Type of fixation, 31
N
Navigating
In lists, 104
In the field, 107
in the Loader, 71
Navigation
in the Loader, 47
Network connections, 58
Nominal voltage, 38
Numerical characters
Editing, 108
Entering, 107
Numerical screen keyboard, 118
Numerical value
Decimal places, 106
Display format, 106
Limit value test, 106
Numerical values
Decimal places, 118
Editing, 119
Entering, 107, 117, 119
Format patterns, 117
Limit value test, 118
O
Offices, 6
Offline, 90
Offline test, 94
Online, 90
Online test, 94
OP properties, 85, 87
Operating mode
Changing, 90
Offline, 90
Online, 90
Overview, 90
Transfer, 56, 91
Operating system
Configuring, 80
Configuring OP 73micro, 71
Updating, 100
Operation feedback, 115
Operation with key combinations, 103
Operator control components, 69, 70
Optical feedback, 115
Overall dimensions, 142
OP 73micro, 141
P
Password
Deleting, 87
Entering, 86
Password, 77
Assigning, 77
Deleting, 78
Editing, 77
Password, 114
Password
Backing up/restoring, 114
Password, 124
Password
Backing up/restoring, 124
Password entry, 77
Password list, 114, 124
Password properties, 86
Password protection, 73, 80
PC-PPI adapter, 14
Pin assignment
Power supply, 146
RS 485, 146
PLC
Connection, 57
Connection of several HMI devices, 59
Connection to the network, 58
Number, 16
Point-to-point connection, 57
Polarity reversal protection, 46, 54
Potential differences, 42, 50
Potentially explosive atmosphere, 20
Power supply, 143, 145
Conductor cross-section, 45, 54
Connecting, 46, 55
Connecting the terminal block, 45, 54
Polarity reversal protection, 46, 54
Wiring diagram, 45, 54
Process management phase, 89
Project
Closing, 114, 125
Operating, 115
Testing, 94
Testing offline, 94
Testing online, 94
Transferring, 90
Protective membrane, 14, 138
Protocol parameters
SIMATIC S7, 61
Protocols
Siemens PLC, 16
Index
OP 73micro, TP 177micro (WinCC flexible)
Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0 187
R
Radiation
High frequency, 17
Range of functions
Alarms, 14
Infotext, 15
Screens, 15
Tags, values, lists, 15
Recommissioning
HMI device, 90
Registered trademarks, 6
Representatives, 6
Reset to factory setting, 92
Reset to factory settings, 96
Restore, 92
Password list, 92
Restoring, 95, 97, 99
In the case of compatibility conflict, 95
Using ProSave, 99
Using WinCC flexible, 97
RS 485, 147
RS 485 (IF 1B), 146
Ruler, 126
S
S7-200
Active node, 58
Passive node, 58
PPI/master mode), 58
PPI/slave mode), 58
Safety instructions
High frequency radiation, 17
Potentially explosive atmosphere, 20
Working on the cabinet, 17
Scope of maintenance, 137
Screen
Changing the orientation, 82
Screen keyboard, 117
Alphanumerical, 120
Keyboard layers, 120
Numerical, 118
Symbolic, 121
Screen saver, 76
Setting, 76, 87
Screens, 15
Security, 113, 124
Security system, 113, 124
Selecting
In the field, 104
Service
On the Internet, 6
Service pack, 139
Setting
Contrast, 74
Delay time, 76
Screen saver, 76
Settings, 75
Side view, 13
Side view of OP 73micro, 12
Siemens PLC
Protocols, 16
SIMATIC S7
Communication partners, 62
Configuring protocol parameters, 61
Network parameters, 62
Soft keys, 69
Global function assignment, 103
Local function assignment, 103
Specifications
Display, 143, 144
Enclosure, 144, 145
Housing, 143
Input, 143, 144
Memory, 143, 144
Overall dimensions, 142
Overall dimensions OP 73micro, 141
Power supply, 143, 145, 146
RS 485, 146, 147
Startup delay, 76
Storage conditions, 25
Support
On the Internet, 6
Switching off
HMI device, 56
Switching on
HMI device, 55
Symbolic screen keyboard, 121
Symbolic value, 106
Symbolic values, 118
Editing, 122
Entering, 111, 122
System alarms
Meaning, 152
Parameters, 151
System keys, 69, 104
T
Tag, 15
Tags, 63
Technical Support, 84
Testing
HMI device, 55
Project, 94
Index
OP 73micro, TP 177micro (WinCC flexible)
188 Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0
Time, 106
Entering, 122
Touch screen
Calibrating, 85
Note, 70
TP 070 projects, 91
Training center, 6
Transfer, 91, 92
Cancel, 47, 56
Manual, 93
Requirements, 92
Transfer mode, 47
Transfer settings, 79, 88
Transferring
Project, 90
Transport conditions, 25
Trend view, 125
Value table, 126
Trends
Limit violation, 125
Trends, 125
Type of fixation, 31, 34
U
Updating the operating system, 92
Upkeep, 137
Use
Conditions, 27
In industry, 20
In residential areas, 20
In the potentially explosive atmosphere, 20
With additional measures, 27
User data
Backing up/restoring, 114, 124
user data areas, 63
Users, 113, 124
V
Value table, 126
Version Info, 75
Version information
Calling, 75
W
Wiring diagram
Configuration computer, 53
Connecting the equipotential bonding circuit, 43, 52
Connecting the power supply, 54
Working on the cabinet, 17
